KEGG   Candidatus Solibacter usitatus: Acid_5231Help
Entry
Acid_5231         CDS       T00412                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acid_5231
Enzymes [BR:sus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Acid_5231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6565421..6566725
Genome map
AA seq 434 aa AA seqDB search
MRTVDLIQRKRGGEELSPEEIAFLVNGYTAGEIPDYQMSAFLMAVFFTGMTDREVSPLTE
AMLHSGETLDLSGIPGVKVDKHSTGGVGDKTSFIVAPLAAAAGVVVPMMSGRALGHTGGT
LDKLESIPGFRTDLSTEQFQKQLAELGLAFIGQSDQLAPADRKLYALRDVTATVESIPLI
SSSIMSKKLAEGIDALVLDVKVGSGAFMKKQVDARRLAQTMVGIGRRMDKKVQALITDMN
QPLGYAIGNALEIMEASQTLQNAGPADLTKLSLELAARMIYLGKKAPTLEEARLIAQNHL
VDGSAYKKFKQVVAAQGGNPQALDKFELLPNATGMREITSPRAGYVAAINAQDIGVSSNM
IGAGRETKDDTIDPAVGIILEVKIGEKVDAGSVLCRLYYTKEDNVDEAAEMVEDAFRVSG
TKPDERELILEVVG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacagttgacttgattcagcgcaagcgcggcggcgaagaactctctcctgaagag
atcgcgttcttggtaaacgggtacaccgccggcgaaattcccgattatcagatgtcggcc
tttctgatggccgtcttcttcaccgggatgactgatcgcgaggtcagcccccttacggag
gccatgctgcactccggcgaaacgctggacctttccgggattcccggcgtgaaggtcgat
aagcattccaccggcggcgtgggcgataagacgagcttcatcgtggcaccgctcgcggcg
gccgcgggagtggtagtgccgatgatgtctgggcgcgcgctcggacataccggggggacg
ctggacaagctggaatccattccgggcttccgcaccgatctcagcaccgaacaatttcag
aagcagctggctgaactgggcctggccttcatcggacaatccgatcaactggcgccggcg
gaccgcaaactgtacgcgttgcgcgatgtgacggcgacggtggaatcgatcccgctgatc
tcttcctcaatcatgtcgaagaagctggcggagggtatcgatgcgctggtactggatgtg
aaggtgggtagcggcgcattcatgaagaagcaggtggacgcgcggcggctggcacaaacg
atggtcggcatcggtcgccggatggataagaaggtacaggcgctgatcacggacatgaat
cagccgctgggttatgcgatcggcaacgcgctggagatcatggaagcctcgcagacgctg
cagaacgcgggccccgctgatttgaccaagctttccctggagctggccgcgcggatgatt
tacctgggcaagaaggcgccgacgctggaagaagcgcggctgattgcgcagaatcatctg
gtggacggctcggcttacaagaaattcaagcaggtggtagcggcgcagggcggcaatccg
caggcgctggacaagttcgagttgctgcccaatgcgaccggaatgcgcgagatcacatcg
ccgcgggccggctacgtggcggcgatcaacgcgcaggatatcggcgtctccagcaacatg
atcggggcgggacgggagaccaaggacgatacgatcgatccggccgtcggcatcatcctg
gaagtcaagatcggcgagaaggtggatgcgggcagcgtgctgtgccgcctctactacacc
aaggaagacaacgtggacgaggccgccgaaatggtggaggatgccttccgcgtgtccggc
accaagcctgatgagcgcgagctcatcctggaagttgtcggctaa

DBGET integrated database retrieval system