KEGG   Candidatus Solibacter usitatus: Acid_5409Help
Entry
Acid_5409         CDS       T00412                                 

Definition
(GenBank) Delta-9 acyl-phospholipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus01040  Biosynthesis of unsaturated fatty acids
sus01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Acid_5409
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Acid_5409
Lipid biosynthesis proteins [BR:sus01004]
 Desaturase
  First
   Acid_5409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ABJ86358
JGI: Acid5409
UniProt: Q01VF7
Position
6777798..6778649
Genome map
AA seq 283 aa AA seqDB search
MEIEFAPVVKREGINWITVTAFAVFHLGAVAALFFFSWPAFFAAVFLYWASLSLGIGMGY
HRLLTHRSYQVPKWLEHSLAVCGALALEGGPIFWVATHRVHHQFSDKHGDPHTPRDGKWW
SHITWMMVGDVTHCDSVACAKYAPDMAADPFYVWLSNYHWIPLTVVGIALLAIGGLPFLL
WGVFFRVTLGLHATWMVNSLTHLWGARRFDTRDDSRNNWFVAALSFGEGWHNNHHAHPTS
ARHGLAWYEVDISWMTIRLLQALGFAKGVKVAKIGPVRERKVA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagattgagttcgcaccggtagtcaaacgggaaggaatcaactggatcacggtgacg
gcgttcgctgtgtttcatctgggcgcggtggccgcactgtttttcttcagctggccggcc
ttcttcgcggcggtgtttctgtactgggcgtcgttgagcctggggatcgggatgggctat
caccggctgttgacgcaccggtcttaccaggttcccaagtggctggagcactcgctggcc
gtctgcggagcgctggcactggagggcggtccgattttctgggtggcgacgcaccgcgtg
catcatcagttctccgacaagcacggcgacccgcacacgccgcgcgatgggaagtggtgg
tcccacatcacctggatgatggtgggcgacgtgacccattgcgattcggtggcgtgcgcc
aagtacgcaccggacatggcggcggacccattctacgtgtggctctcgaattaccattgg
attccgctgacggtggtggggatcgcgctgctcgcgatcggcggactgccgttcctgctg
tggggcgtcttcttccgcgtcacgttgggtttgcacgcgacctggatggtcaactcgctg
actcacctgtggggagcgcgccggttcgatacgcgggacgactcgcgcaacaactggttc
gtggcggcgttgagcttcggcgagggctggcacaacaatcaccacgcacacccgacatct
gcgcgtcacgggctggcgtggtacgaagtggatatttcctggatgacgatccgcctgctg
caggcgctgggcttcgccaaaggcgtgaaagtggcgaagatcgggccggttcgcgagcgc
aaagtcgcgtaa

DBGET integrated database retrieval system