KEGG   Candidatus Solibacter usitatus: Acid_5701Help
Entry
Acid_5701         CDS       T00412                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_5701
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acid_5701
Enzymes [BR:sus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Acid_5701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7141637..7142929)
Genome map
AA seq 430 aa AA seqDB search
MTNRADEILREWETDPRWRGIKRPYSAENVLRLRGSVRVEYTLARMGAERLWHLLHTEPY
VAALGALTGNQAVQQVQAGLKAIYLSGWQVAGDANLGGQMYPDQSLYPANSVPAVVRAIN
NALQRADQIHSAEGAHGHCWFAPIVADAEAGFGGPLNAFELMKGMIEAGAGAVHFEDQLS
SAKKCGHLGGKVVVPIAEFVQKLVAARLAADVMGIPTVLVARTDANSAGLLLSDIDSRDM
PFLSGGRTSEGFFHFRGGIQAAIARGVAYAPYADMLWCETSEPNLAEAREFAEAIHARFP
GKLLAYNCSPSFHWRKKLDDATIGRFQQELGAMGYKFQFVTLAGFHALNLSMFSLARAYA
EVGMAAYASLQEHEFEVSREHGYSAVRHQRFVGTGYFDEVQQVISGGQSSTAALAGSTEA
AQFNGVEVTP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgtgccgacgagattttgcgggagtgggagaccgacccgcggtggagagga
atcaaacggccttacagcgcggaaaatgttctgcggctgcgcggctcggtgcgggtggag
tacacgctggcgcgcatgggcgcggagcggctgtggcatctgctgcacaccgaaccctac
gtggcggcgctgggggcgctgacgggaaaccaggcggtgcaacaggtgcaggcagggcta
aaggctatctatttgagcggctggcaggtagccggcgacgccaacctgggcggccagatg
tacccggaccagagcctgtatccggcgaacagcgtgccggcggtggtgcgggcgatcaat
aacgcgctgcagcgggccgaccagatccacagcgcggagggcgcgcatgggcactgctgg
ttcgcgccgatcgtggccgatgcggaggcaggcttcggcggaccgctcaatgctttcgaa
ctcatgaagggaatgatcgaggcgggtgcgggcgcggtgcacttcgaggatcagctttcc
tcggcgaagaagtgcgggcacctgggcggcaaggtagtggtgccgattgccgaattcgtg
cagaagctggttgcagcacggctggcagcggacgtgatggggattccgacggtgctggtg
gcgcgtacggatgcgaatagcgcgggcctgctgctgagcgacatcgactcgcgcgatatg
ccgtttttgagcggcgggcggaccagcgagggcttcttccatttccgcggcgggattcag
gcggcgatcgcgcgcggcgtggcgtatgcgccctatgcggacatgctgtggtgcgagacg
tccgagccgaatttggcggaggcgcgggagttcgcggaggcgatccacgcgcggttcccc
gggaaactgctggcctacaactgctcgccgagctttcactggaggaagaaactggacgac
gccacgatcgggcgcttccaacaggagctgggtgcgatgggttacaagttccagttcgtg
acgctggcgggattccacgcgctcaacctgagcatgttttccctggcgcgcgcgtatgcg
gaggtgggaatggcggcgtacgcgagtttgcaggagcacgagttcgaggtgtcgcgcgaa
catgggtactcggcggttcggcaccagcggttcgtgggcacgggatacttcgacgaagtg
cagcaggtgatctccggcggacagagctccacggcggcgctggcgggttcgacggaggcg
gcgcagttcaatggcgtggaggtgacgccgtag

DBGET integrated database retrieval system