KEGG   Candidatus Solibacter usitatus: Acid_5702Help
Entry
Acid_5702         CDS       T00412                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_5702
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acid_5702
   00630 Glyoxylate and dicarboxylate metabolism
    Acid_5702
Enzymes [BR:sus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acid_5702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7143063..7144640
Genome map
AA seq 525 aa AA seqDB search
MFATQEKSIQITAPVTGAQQLILSEEALRFLARLARSVEPRRRQLLDDRERRQQEIDAGA
LPEFLPATARIRAREWYVAPIPADLQDRRVEITGPVDRKMIINALNSGANVFMADFEDSN
SPTWGNVMQGQVNLRDAVRGVITYTSPEGKRYELCETPAVLMVRPRGWHLVEKHVLVDGE
PISASLFDFGLFFFHNARTLIANGTGPYFYLPKMESHLEARLWNEVFILAQQELGISRGT
IRATALIETIFAAFEMDEILWELREHSAGLNCGRWDYIFSFIKKFRNHSGFVLPDRVQVG
MDRHFLRSYADLLIHTCHRRGAHAMGGMAAQIPIKNDPEANAAALEKVRLDKLREVWAGH
DGTWVAHPALVSLARDVFDTYMPFPNQIDKKTSIDVNPADLLTVPTGEITLEGLSRNIDI
GLQYLTTWLCGNGCVPIYNLMEDAATAEISRAQVWQWLTHGAHLSNGQRVTPVLVRETLE
HHRRRLESQFPARELSHAVRLFETLIINPEFTDFLTAPAYDLLDA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacacaagagaagtccatccagatcaccgcccccgtcactggcgcgcagcaa
cttatcctcagcgaagaggccctccgctttctcgccaggctggcgcgctcggtcgaaccc
cgccgccgtcaactgctcgatgaccgtgagcggcgccagcaggaaatcgatgccggcgcc
ctgcccgaatttctccccgccaccgcgcgcatccgcgcccgcgagtggtacgtggcgccc
atccccgccgacctccaggatcgccgcgtggaaatcaccggcccggtcgatcgtaagatg
atcatcaacgccctcaactccggcgccaatgtcttcatggcggattttgaggattccaac
tcgcccacctggggcaacgtgatgcagggccaggtaaacctccgcgacgccgtacgcggc
gtcatcacctacaccagccccgaaggcaagcgctacgagctctgtgaaacgcccgcagtc
ctcatggtccgcccgcggggctggcacctggttgagaagcatgtcctggtggatggcgaa
ccgatctccgcctccctcttcgattttggcctcttcttcttccacaacgcccggacgctg
atcgccaacggcaccggcccgtatttctacctcccgaaaatggagagccatctcgaagcc
cgcctctggaatgaggtgttcatcctcgcccagcaggaactcggcatctcgcgcggcacc
atccgcgccaccgcccttatcgagaccatcttcgccgccttcgaaatggacgagatcctc
tgggaactccgcgagcactcggccggcctgaattgcggccgctgggactacatcttcagc
ttcatcaaaaaattccgcaaccactccggcttcgtgctgccggaccgcgtccaggtcggc
atggaccgccatttcctgcgctcctatgccgatctgctgatccacacctgccatcgccgc
ggcgcgcatgccatgggcggcatggccgcgcagatccccatcaaaaacgatcccgaggcc
aatgccgccgcgctcgaaaaggtgcggctcgataagcttcgcgaagtttgggccggccac
gatggcacctgggttgcccatcccgccctcgtatcgctcgcccgcgatgtcttcgacacc
tacatgccgttccccaaccagatcgataagaagacgtccatcgacgtcaaccccgccgac
ctgctgaccgtccccaccggcgagatcaccctcgaaggcctgagccgcaatatcgatatc
ggcctccagtacctcacgacctggctgtgcggcaacggctgcgttcccatctataacctg
atggaggatgccgccaccgccgaaatctcccgcgcccaggtctggcagtggctgacccac
ggcgcgcacctctcgaatggccagcgcgtcaccccggtcctcgtacgcgaaaccctggag
caccaccgccgccgcctcgaatcccaattcccggcgcgcgaactctcccatgccgtccgc
ctcttcgagaccctgatcatcaaccccgaattcaccgatttcctgaccgcgccggcctac
gacctgttagatgcgtaa

DBGET integrated database retrieval system