KEGG   Candidatus Solibacter usitatus: Acid_5702Help
Entry
Acid_5702         CDS       T00412                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00620  Pyruvate metabolism
sus00630  Glyoxylate and dicarboxylate metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01120  Microbial metabolism in diverse environments
sus01200  Carbon metabolism
Module
sus_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acid_5702
   00630 Glyoxylate and dicarboxylate metabolism
    Acid_5702
Enzymes [BR:sus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acid_5702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3499 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABJ86649
JGI: Acid5702
UniProt: Q01UM1
Position
7143063..7144640
Genome map
AA seq 525 aa AA seqDB search
MFATQEKSIQITAPVTGAQQLILSEEALRFLARLARSVEPRRRQLLDDRERRQQEIDAGA
LPEFLPATARIRAREWYVAPIPADLQDRRVEITGPVDRKMIINALNSGANVFMADFEDSN
SPTWGNVMQGQVNLRDAVRGVITYTSPEGKRYELCETPAVLMVRPRGWHLVEKHVLVDGE
PISASLFDFGLFFFHNARTLIANGTGPYFYLPKMESHLEARLWNEVFILAQQELGISRGT
IRATALIETIFAAFEMDEILWELREHSAGLNCGRWDYIFSFIKKFRNHSGFVLPDRVQVG
MDRHFLRSYADLLIHTCHRRGAHAMGGMAAQIPIKNDPEANAAALEKVRLDKLREVWAGH
DGTWVAHPALVSLARDVFDTYMPFPNQIDKKTSIDVNPADLLTVPTGEITLEGLSRNIDI
GLQYLTTWLCGNGCVPIYNLMEDAATAEISRAQVWQWLTHGAHLSNGQRVTPVLVRETLE
HHRRRLESQFPARELSHAVRLFETLIINPEFTDFLTAPAYDLLDA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacacaagagaagtccatccagatcaccgcccccgtcactggcgcgcagcaa
cttatcctcagcgaagaggccctccgctttctcgccaggctggcgcgctcggtcgaaccc
cgccgccgtcaactgctcgatgaccgtgagcggcgccagcaggaaatcgatgccggcgcc
ctgcccgaatttctccccgccaccgcgcgcatccgcgcccgcgagtggtacgtggcgccc
atccccgccgacctccaggatcgccgcgtggaaatcaccggcccggtcgatcgtaagatg
atcatcaacgccctcaactccggcgccaatgtcttcatggcggattttgaggattccaac
tcgcccacctggggcaacgtgatgcagggccaggtaaacctccgcgacgccgtacgcggc
gtcatcacctacaccagccccgaaggcaagcgctacgagctctgtgaaacgcccgcagtc
ctcatggtccgcccgcggggctggcacctggttgagaagcatgtcctggtggatggcgaa
ccgatctccgcctccctcttcgattttggcctcttcttcttccacaacgcccggacgctg
atcgccaacggcaccggcccgtatttctacctcccgaaaatggagagccatctcgaagcc
cgcctctggaatgaggtgttcatcctcgcccagcaggaactcggcatctcgcgcggcacc
atccgcgccaccgcccttatcgagaccatcttcgccgccttcgaaatggacgagatcctc
tgggaactccgcgagcactcggccggcctgaattgcggccgctgggactacatcttcagc
ttcatcaaaaaattccgcaaccactccggcttcgtgctgccggaccgcgtccaggtcggc
atggaccgccatttcctgcgctcctatgccgatctgctgatccacacctgccatcgccgc
ggcgcgcatgccatgggcggcatggccgcgcagatccccatcaaaaacgatcccgaggcc
aatgccgccgcgctcgaaaaggtgcggctcgataagcttcgcgaagtttgggccggccac
gatggcacctgggttgcccatcccgccctcgtatcgctcgcccgcgatgtcttcgacacc
tacatgccgttccccaaccagatcgataagaagacgtccatcgacgtcaaccccgccgac
ctgctgaccgtccccaccggcgagatcaccctcgaaggcctgagccgcaatatcgatatc
ggcctccagtacctcacgacctggctgtgcggcaacggctgcgttcccatctataacctg
atggaggatgccgccaccgccgaaatctcccgcgcccaggtctggcagtggctgacccac
ggcgcgcacctctcgaatggccagcgcgtcaccccggtcctcgtacgcgaaaccctggag
caccaccgccgccgcctcgaatcccaattcccggcgcgcgaactctcccatgccgtccgc
ctcttcgagaccctgatcatcaaccccgaattcaccgatttcctgaccgcgccggcctac
gacctgttagatgcgtaa

DBGET integrated database retrieval system