KEGG   Candidatus Solibacter usitatus: Acid_5726Help
Entry
Acid_5726         CDS       T00412                                 

Definition
4Fe-4S ferredoxin
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sus  Candidatus Solibacter usitatus
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Acid_5726
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Acid_5726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7171800..7173407
Genome map
AA seq 535 aa AA seqDB search
MDFDYIVVGSGFGGSVCAHRLTEKGYRVGVMEMGCRWTPKNLPAINWRLRHWIWRPGLGL
RGFFNIDPFRHVVVMHGCAVGGGSITYANTSLVPGDTIWENGSWAGVADWKAEMPRHYET
AIRMLGVMENRILGPADRILRQVAEEQGVGPSFYRTRVAVFEGPEGETPGTAYPDPYFGG
KGPERTTCIGCGGCMMGCRFGAKNTLDQNYLYLAEQAGTRVFAETRVVDVRPLEGSSDGS
FGYEVFTVRSTMLGGGRRRFTCRGVVVAASALGTLDLLFRLKEKGSLPAISAQLGNRVRT
NAESLIGVRVPGCREDLSQGVAIGSGCYLDQYTHIEATRYPAGSDAMGLLATVLTGGEPG
RTRILLWLRELAVSLLRHPIRTLRSLHPFGWARESIILLCMQTLDGYIEMRMGRPWFWPF
RRVLRTRGPRIPTYIPQANEFARKVAMAAGGTPMSMVTEILFDVPGTAHILGGCPMAASA
AEGVVDGRNHLFGYRNLYVCDGSVIAANLGVNPSLTICALAERAMSFIPPAPQAE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgactacatcgtggtcggctcgggtttcggcggcagcgtctgcgcccaccgg
ctcaccgagaaaggctaccgggtcggcgtgatggagatgggctgccgctggacgccaaag
aacctgcctgcgatcaactggcggctgcggcattggatctggcgaccgggactcggattg
cgcggcttcttcaacatcgacccctttcgccatgtggtggtaatgcacggctgcgcggta
ggcggcggctccattacctacgcgaacacgtcgctggtgccgggggacacgatctgggag
aacggatcgtgggccggcgtcgcggactggaaggcggagatgccccgccactacgagacc
gcgatccgcatgctgggcgtgatggagaaccgcatcctgggtccggctgaccggatcctg
cggcaggttgccgaggaacagggggtcgggccgagtttctatcgcaccagggtcgcggtg
ttcgaagggccggaaggagaaactccgggaacggcatatcccgatccctatttcggcggc
aagggaccggaacggaccacttgcatcggctgcggcggctgcatgatgggctgccggttc
ggcgccaagaatacgctggaccagaactacttataccttgcggaacaggccggcacgcgg
gtctttgccgaaacccgggtagtggacgtgcggccgctcgagggtagctccgatggaagc
ttcgggtatgaagtgttcactgtccgttccacgatgctgggcggtgggcggcgccgcttc
acctgccggggtgtggttgtcgccgcctccgcgctgggcacgctggacctgctcttccgg
ctgaaggagaagggctcgctgccggcgatcagcgcgcaactcggaaaccgggtgcggacc
aacgccgagtcgctgatcggcgtccgggtgccgggctgccgtgaggatttgtcgcagggt
gtggcgatcggatcgggctgctacctggaccagtacacgcacatcgaagcgacgcgttat
ccggcgggctcggatgcgatgggactgctggcgaccgtactgaccggcggagaaccgggc
cgtacccgcatcctgctctggctgcgcgaactggcggtctcgttgttgcggcacccgatc
cggacgctgcgcagcctgcacccattcggctgggcgcgcgagtcgattatcctgctctgc
atgcaaaccctggacgggtacatcgagatgcgcatggggcgtccgtggttctggccgttc
cgccgcgtgctgcgcacgcgggggccgcgcatcccgacgtacatcccgcaggccaacgaa
ttcgcgcgcaaagtggcgatggcggccggcggcactcccatgagcatggtcacggaaatc
ctgttcgacgtacccggcacggcgcacattctgggaggatgtcccatggcggcctccgcc
gcggagggagtggtggatgggcggaaccacctgttcggctatcggaatctttacgtctgc
gatggctcggtcattgccgccaacctgggcgtcaacccgagcctgaccatttgcgcgctc
gcggagcgggcgatgagcttcatcccgcccgccccgcaggcggagtag

DBGET integrated database retrieval system