KEGG   Candidatus Solibacter usitatus: Acid_6227Help
Entry
Acid_6227         CDS       T00412                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase related
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00521  Streptomycin biosynthesis
sus00523  Polyketide sugar unit biosynthesis
sus01130  Biosynthesis of antibiotics
Module
sus_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Acid_6227
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acid_6227
Enzymes [BR:sus01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Acid_6227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABJ87153
JGI: Acid6227
UniProt: Q01T67
Position
7805102..7805623
Genome map
AA seq 173 aa AA seqDB search
MVPECARGIGSLITSPSSEHLISGVKVEPYALFPDDRGYFLEVHRMGRGLAAAFPPATTQ
MSAALNYPGTVKAFHFHLHQHDCWAPVYGLLQVALVDLRLGSATYGARNTLYVGALRPWQ
ILIPPGVGHGYKVIGNKEAMLVYLTDQFYNPKDEGRVPYNDPGINYDWETQNK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtggtccccgaatgtgcccggggaatcggcagcctgatcacctctccgtcatcggagcac
ctgatctcgggcgtcaaagtcgagccctacgcgctctttccggacgatcgcggctacttc
cttgaagttcatcgcatgggccgcggcctcgccgcagctttccctccagcgaccacccag
atgtcggcggcattaaactatcccggcaccgttaaggccttccattttcatctccaccag
cacgattgctgggcacccgtgtacggcctgctgcaggtggccctggtggatctgcgcctc
ggttcggcgacttacggcgcacggaacactctctacgtcggcgcgctccgtccctggcag
atcctgattccgccaggcgtggggcacggctacaaagtaatcggtaacaaggaagccatg
ctggtctatctgaccgaccagttttacaatcccaaggacgagggccgtgttccgtacaac
gaccccggaatcaattacgattgggagacgcagaataaatag

DBGET integrated database retrieval system