KEGG   Candidatus Solibacter usitatus: Acid_6473Help
Entry
Acid_6473         CDS       T00412                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_6473
   00030 Pentose phosphate pathway
    Acid_6473
   00051 Fructose and mannose metabolism
    Acid_6473
   00052 Galactose metabolism
    Acid_6473
   00500 Starch and sucrose metabolism
    Acid_6473
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_6473
  Nucleotide metabolism
   00230 Purine metabolism
    Acid_6473
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acid_6473
Enzymes [BR:sus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Acid_6473
    5.4.2.8  phosphomannomutase
     Acid_6473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8114411..8115775
Genome map
AA seq 454 aa AA seqDB search
MFKSTIFREYDIRGIADVELLDADVEQLGRAFGTYMRRHAGSKVNLGRDTRLSSPRLRDA
LIRGLMASGCQVTDIGVVPTPVLYYSVFHLKADGAVMITGSHNPSEFNGFKTVCGASTIH
GEAIQEIRMLIERQDFESGEGTEASADMVTPYVEEVASQFHFKRRVGCVFDAGNGTGGPV
MHRILERINVAATEMYFEMDGRFPNHHPDPTVPENLRALIDKVRETKADLGIAFDGDTDR
IGAVDDQGTVVWGDQLMIIYGREILTRKPGATFIGEVKCSQLMYDDLKARGGNPIMWKTG
HSLIKAKMQETGAELAGEMSGHMFFADRYYGFDDALYSACRLLEIVSNSGQPLSAQLADM
PKTVTTPEIRFDCPDELKFAVVSRAMAELRAKHKTLDVDGVRVIFPNGWGLVRASNTQPV
LVMRFEATTPELLQEYRREVESVVERAKGAAQSA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatcgacgatctttcgggaatacgacattcgcggcattgccgacgtggaattg
ctggatgccgatgtggaacaactgggccgcgcgttcggcacgtatatgcggcgtcatgcg
ggcagcaaggtcaacctgggccgtgatacgcgccttagttcgccgcgcctgcgcgatgcc
ctgattcgcggtctgatggccagcggatgccaggtcaccgacatcggcgtggttcccact
ccggtgctctactattcggtatttcacctcaaggccgatggcgccgtgatgattacgggc
agccacaacccgagcgagtttaacggcttcaaaaccgtgtgcggcgcctctacgatccat
ggcgaagcgattcaggagatccgaatgctgatcgagcggcaggacttcgagagcggggag
ggcacggaggcctcggccgacatggtgacgccctacgtggaggaagtcgcgtcgcagttt
cacttcaagcgtcgcgtgggctgcgtcttcgacgccggcaatggcaccggcggcccggtg
atgcaccgcattctggaacgcatcaacgtcgccgcgaccgagatgtatttcgagatggac
gggcgcttccccaaccatcatcccgacccgacggttccggaaaatctgcgggccctgatc
gacaaggtccgcgagaccaaggccgatctcggcatcgcgttcgatggcgacacggaccgc
atcggcgcggtggacgaccaggggacggtcgtctggggcgatcagctgatgatcatctac
gggcgcgagattctgacgcgcaaacccggcgccacgttcattggcgaggtcaaatgctcg
cagttgatgtatgacgatttgaaggcgcgcggcggcaatccgatcatgtggaagacgggc
cactcgctgatcaaggccaagatgcaggagactggcgccgaactggcaggggagatgagc
ggccacatgttcttcgccgaccgctactacggcttcgacgatgcgctctattcagcgtgc
cgcctgctggaaatcgtctccaactccggccagccgctctccgcgcagctggcggatatg
ccgaagactgtgaccactcctgagatccgcttcgattgtcccgacgagttgaaatttgcc
gtggtcagccgggccatggcggagctgcgcgcgaagcacaagacgctcgatgtggatggc
gtgcgtgtgattttcccgaacggctggggcttggtgcgcgcatccaacacgcagccggtg
ctggtaatgcgatttgaggcgacgacgcctgaattgctgcaggagtaccggcgcgaggtg
gaatccgtcgtggagcgcgcgaagggtgcggcgcaatccgcgtag

DBGET integrated database retrieval system