KEGG   Candidatus Solibacter usitatus: Acid_6502Help
Entry
Acid_6502         CDS       T00412                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_6502 (tpiA)
   01230 Biosynthesis of amino acids
    Acid_6502 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_6502 (tpiA)
   00051 Fructose and mannose metabolism
    Acid_6502 (tpiA)
   00562 Inositol phosphate metabolism
    Acid_6502 (tpiA)
Enzymes [BR:sus01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acid_6502 (tpiA)
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acid_6502 (tpiA)
  Exosomal proteins of bladder cancer cells
   Acid_6502 (tpiA)
  Exosomal proteins of melanoma cells
   Acid_6502 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8150447..8151196)
Genome map
AA seq 249 aa AA seqDB search
MRKPVMAGNWKMYKTPAETIAFFEKFRPLVEKSSHCEIVICPPFTNLAAAVDAVRGTSIR
VGAQNVGWAKEGAFTGEVSGPMLNAMGVSHVIIGHSERRQYFNETDETVLKRTQAALEFG
LTPIVCVGELLADREGGRTEAVLAGQFQKGIAGLTEQQFAKIVIAYEPVWAIGTGKTATP
EIAADTHRAIRGQVREKFGKEAADAVRILYGGSVKPDNAKVLMGQPEIDGVLVGGAALDP
VSFASIVNF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccagtcatggcgggcaattggaagatgtacaaaacgcccgcggaaaccatt
gcgttcttcgagaaattccggccgctggtcgagaagtcctcgcactgtgagatcgtgatc
tgccctcccttcacgaacctcgccgcggccgtcgatgccgtgagaggcacgtcgatccgg
gtcggcgcgcagaatgtcggctgggccaaggaaggcgccttcacgggcgaggtttcgggc
ccgatgctcaatgccatgggcgtcagtcacgtcatcatcggccacagcgaacgccgccaa
tatttcaacgagaccgatgagaccgtgctgaagcggactcaggccgcgctcgaattcggg
ctgacgccgattgtctgcgtcggcgaactactggccgaccgcgaaggcgggaggaccgaa
gccgtgctcgccggacagttccagaagggcatcgccggattgacggagcagcagttcgcg
aagatcgtgatcgcctatgagcccgtgtgggccatcggtaccggcaagaccgcgacgccc
gagatcgcggccgatacgcaccgcgcgatccgcgggcaggtccgcgagaagttcggtaag
gaagcggccgacgcggtccgcattctgtatggcggcagcgtgaagcccgataacgcaaag
gtcctgatggggcagccggaaatcgacggcgtcctggtgggcggcgcggcgctggacccg
gtgtcgttcgcttcgatcgttaacttctaa

DBGET integrated database retrieval system