KEGG   Candidatus Solibacter usitatus: Acid_6549Help
Entry
Acid_6549         CDS       T00412                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid_6549
   00052 Galactose metabolism
    Acid_6549
   00500 Starch and sucrose metabolism
    Acid_6549
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_6549
Enzymes [BR:sus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acid_6549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8210203..8211057
Genome map
AA seq 284 aa AA seqDB search
MRIRKAVITAAGQSQRALPLQTLIDRDGQDKPVICILIEQALAAGVEEICVVVWPGDETR
YAQAAGRHTASVRFIAQPAPTGYGQAILCAREFTGADPFLHMVGDHLYVTTGARLSAQRL
VELAAAEECSVSGVQATRESLLPRFGTVAGRRISGRSDLYRVETVIEKPTPTEAEQRLMV
PGIRAGYYLCFFGIHVLTPAVMELLAKGAPTLSAALAELARHEQYLALEDDGRRYDLGAP
YGLLIAQLALALNGPDRTQVLSQMLELLADRELRAAAATGGARQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaatcaggaaagctgtgattacggctgcgggacagagccagcgggcgttgccgctg
cagacgctgatcgatcgcgacgggcaggacaagccggtgatctgtattctgatcgagcag
gcactggcggcgggcgtggaagagatctgcgtggtggtgtggccgggcgacgaaacgcgc
tatgcccaggcggcggggcggcatactgcgtcggtccggttcatcgcgcagccggcgccg
acggggtacgggcaggcgattttgtgcgcgcgcgaattcacgggcgcggatccgtttctg
catatggtgggcgatcacctctacgtgacgacgggtgcgaggctttcggcgcagcggttg
gtggaactcgcggcggcggaggagtgctcggtctccggcgtccaggcgacgcgcgagagt
ttgctgccgcgcttcggcaccgtggcggggcggcgcatcagcgggcgcagcgatctgtat
cgcgtggaaaccgtgatcgagaagcccacgccgacggaggccgaacagcggctgatggtg
ccggggattcgggcgggatattatctctgtttcttcggcatccacgtgctgacgccggcg
gtgatggaactgctggcgaagggtgcgccgacactttccgcggcgctggcggaactggcg
aggcatgagcaatacctggcgctggaagacgacgggcggcgctacgacctgggcgcgcca
tacggactgttgatcgcgcagctggcgctggcgctgaacggaccggatcgcacgcaggtg
ttgtcgcagatgctggaattgctggccgaccgggagctgcgcgcggcggcggcaacggga
ggagcgcggcagtga

DBGET integrated database retrieval system