KEGG   Candidatus Solibacter usitatus: Acid_6549Help
Entry
Acid_6549         CDS       T00412                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00040  Pentose and glucuronate interconversions
sus00052  Galactose metabolism
sus00500  Starch and sucrose metabolism
sus00520  Amino sugar and nucleotide sugar metabolism
sus01100  Metabolic pathways
sus01130  Biosynthesis of antibiotics
Module
sus_M00362  Nucleotide sugar biosynthesis, prokaryotes
sus_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid_6549
   00052 Galactose metabolism
    Acid_6549
   00500 Starch and sucrose metabolism
    Acid_6549
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_6549
Enzymes [BR:sus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acid_6549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABJ87471
JGI: Acid6549
UniProt: Q01S99
Position
8210203..8211057
Genome map
AA seq 284 aa AA seqDB search
MRIRKAVITAAGQSQRALPLQTLIDRDGQDKPVICILIEQALAAGVEEICVVVWPGDETR
YAQAAGRHTASVRFIAQPAPTGYGQAILCAREFTGADPFLHMVGDHLYVTTGARLSAQRL
VELAAAEECSVSGVQATRESLLPRFGTVAGRRISGRSDLYRVETVIEKPTPTEAEQRLMV
PGIRAGYYLCFFGIHVLTPAVMELLAKGAPTLSAALAELARHEQYLALEDDGRRYDLGAP
YGLLIAQLALALNGPDRTQVLSQMLELLADRELRAAAATGGARQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaatcaggaaagctgtgattacggctgcgggacagagccagcgggcgttgccgctg
cagacgctgatcgatcgcgacgggcaggacaagccggtgatctgtattctgatcgagcag
gcactggcggcgggcgtggaagagatctgcgtggtggtgtggccgggcgacgaaacgcgc
tatgcccaggcggcggggcggcatactgcgtcggtccggttcatcgcgcagccggcgccg
acggggtacgggcaggcgattttgtgcgcgcgcgaattcacgggcgcggatccgtttctg
catatggtgggcgatcacctctacgtgacgacgggtgcgaggctttcggcgcagcggttg
gtggaactcgcggcggcggaggagtgctcggtctccggcgtccaggcgacgcgcgagagt
ttgctgccgcgcttcggcaccgtggcggggcggcgcatcagcgggcgcagcgatctgtat
cgcgtggaaaccgtgatcgagaagcccacgccgacggaggccgaacagcggctgatggtg
ccggggattcgggcgggatattatctctgtttcttcggcatccacgtgctgacgccggcg
gtgatggaactgctggcgaagggtgcgccgacactttccgcggcgctggcggaactggcg
aggcatgagcaatacctggcgctggaagacgacgggcggcgctacgacctgggcgcgcca
tacggactgttgatcgcgcagctggcgctggcgctgaacggaccggatcgcacgcaggtg
ttgtcgcagatgctggaattgctggccgaccgggagctgcgcgcggcggcggcaacggga
ggagcgcggcagtga

DBGET integrated database retrieval system