KEGG   Candidatus Solibacter usitatus: Acid_6569Help
Entry
Acid_6569         CDS       T00412                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_6569
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid_6569
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acid_6569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8231414..8233405
Genome map
AA seq 663 aa AA seqDB search
MEVMLRYALFCALLSSAHAAAPALMPLPATMRPAAGKLTIDSSFKATLSGAADAHLEAAI
ARFTAQLSRQTGIPMFANKGAAARLRVECASAGGEVPKLGDNEAYTLDVTADGATLKAPE
RAGVLHGLATFAQLVMLGDQGYEVPAVHIEDRPRFPWRGLMLDSARHFMPLAVVKRNLDA
MAAVKLNVFHWHLSEDQGFRVESKRYPKLQEKGSDGLFYTQSEIRDIVSYARDRGIRVVP
EFDIPGHTTAWMVGYPELGTVPGPYEIGRKWGVYENALDPSREETYTFLDNFFEEITPLF
ADLYFHIGGDEVVARQWNASARVQAWAKEHNLKDAHAIQAYFNTRVQKLLQKRGKVLIGW
DEVLHPDLPKDIVVQSWRGQKSLAEAATKGYRGILSWGYYLDHLSPAKFHYGVDPMSSDA
DKLAPEQASRILGGEACMWAEYTTSETVDSRIWPRAAVIAERLWSPAATVDVESMYTRME
AVSRELEWTGVQHRANYAPMLDRMTGGAPAEPLRILADAVEGLGLSPRARVAKYTSLTPM
NRLADAARPESESVHALELAAAKVAADPNGSTAEAAALRTAFTRWAANDARFQELAAGNP
LLAELKPLSKDLAALGNAGLALLDGRPAPAGFAAELTRMERPLAEVSLAATRPVKILLNA
GRK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgcttcgatatgcgctcttttgcgcccttctttccagtgctcatgcggcg
gcgcccgcgttgatgccgctgcccgccacgatgcggccggccgctggcaaactgacgatc
gattcgagtttcaaggcgacgctttccggcgcggctgatgcgcacctggaggcggcgatc
gcgcgcttcacggcgcaactctcgcggcagaccgggatccctatgttcgcgaacaagggc
gcagcagccaggctgcgcgtcgaatgcgcgtccgccggcggggaggttcccaagctcggc
gacaacgaggcgtacacgttggacgtcacggcggatggagccacactcaaagcgcccgag
cgcgccggcgtgctgcacggcctggcaaccttcgcacaactggtaatgctgggcgatcag
ggttacgaagtaccggccgtccacattgaagatcgaccgcggtttccgtggcgcggactg
atgctggattcggcgcggcacttcatgccgcttgcggtggtgaaacgcaacctggacgcg
atggcggccgtgaagctcaacgtcttccactggcacctttccgaggaccagggcttccgc
gtggagagcaagcgctatcccaagctgcaggagaaggggtccgacggcctcttctacacg
cagtccgagatccgcgacattgtgagctacgcgagggatcgcggcatccgcgtggtgccg
gagttcgacatcccgggacacaccacggcatggatggtgggctaccccgaattgggtacc
gttcccgggccgtatgaaatcgggcgcaagtggggcgtgtacgaaaacgcgctggatccg
agccgcgaagagacctacactttcctggataacttcttcgaagaaatcacgccgctcttc
gccgacctttacttccacatcggcggcgacgaagtagtggccaggcagtggaacgcgtcg
gcgcgcgttcaggcgtgggccaaggaacacaacctgaaagacgcgcacgcgatccaggcg
tacttcaacacgcgcgtgcagaaactgctgcagaagcgcggcaaggtgctgatcggctgg
gacgaggtactgcatcccgacctgccgaaggacattgtggtgcagtcctggcgcgggcag
aaatcgctggccgaagcggcgactaaaggctatcgcgggattctctcgtggggctattat
ctggatcacctgagcccggcgaagttccactatggcgtggacccgatgtcgagcgacgcc
gacaaactagcgccggagcaggcctcgcgcatcctcggaggcgaagcatgcatgtgggcc
gaatacacgacgtcggaaaccgtggattcgcggatctggccgcgcgcggcggtgatcgcg
gagcgcttgtggtcgcccgccgcgactgtggatgtggaatcgatgtacacgcggatggaa
gccgtcagccgcgagctggaatggacgggcgtgcagcatcgcgccaattacgcgcccatg
ctggaccgcatgacgggcggcgctccggcggagcccttgcgcatactggcagacgctgtg
gagggcctgggcctgagtccccgagcgcgagtcgcgaaatacaccagcctgacgccgatg
aaccgtttggccgatgccgcgcgccccgagagcgagagcgtgcacgcgctcgaactggcg
gccgccaaggtggctgccgatcccaacggcagcacggcggaggccgcggcgctgcgcact
gcgttcacgcggtgggcagccaacgacgcgcgcttccaggaactcgcggccggcaatccg
ctgctcgcggaattgaagccgctatcaaaggatctggccgcgctcggcaacgccggtctg
gcgctgctggatggcaggccggcccccgccggattcgccgccgagttgacgcgaatggag
cggccccttgccgaggtctcgctcgcggcgacgcgcccggtgaagatcctgctgaacgcc
ggcaggaagtag

DBGET integrated database retrieval system