KEGG   Candidatus Solibacter usitatus: Acid_6708Help
Entry
Acid_6708         CDS       T00412                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00790  Folate biosynthesis
sus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acid_6708
Enzymes [BR:sus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Acid_6708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABJ87629
JGI: Acid6708
UniProt: Q01RU1
Position
8408907..8409752
Genome map
AA seq 281 aa AA seqDB search
MRKLFFWKLKQHEIRLGERTVLMGVLNVTPDSFSDGGKYSDPDRAFARAIELEEQGADII
DIGAESTKPGSTRVSVAEEMRRLIPVLKRLKDRLGIPISVDTYKAEVAERALELGVEIIN
DPSGLTFEPQLARTAANMNAGLILNHMRGTPETWAKLGPMPDPLSTIGRDLDAMISRARH
AGVDKAHMVIDPGLGFGKRKEQNAVILARLGELNPLDLPIMVGPSRKSFLAHPDLEETKF
ATAAAVTAAILGGAHIVRVHDVREMRAVADVADEIVRGRPE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaactctttttttggaaattgaagcagcacgagatccgcctgggcgaacgcacc
gtgctgatgggcgtgctcaatgtaacgcccgattcgttttccgatgggggcaagtactcg
gacccggaccgcgctttcgcgcgggcgatcgagctggaggaacagggcgcggacatcatc
gatatcggcgcggaatccaccaagccggggtccacgcgagtatcggtggccgaggagatg
cgccggctgatcccggtgctgaagcggttgaaggaccggctgggcattccgatctcggtg
gacacatacaaggccgaggtggccgagcgcgcgctagagctgggcgtggagatcatcaac
gacccttcgggactgacgttcgaaccgcagctggcgcggaccgcggccaacatgaatgcc
ggattgattttgaatcacatgcgcgggacgccggagacatgggcgaagctgggtccgatg
ccggatccgctctcgacgatcgggcgcgatctggatgcgatgatcagccgggcgcggcac
gcgggcgtggacaaggcccacatggtgatcgatccgggcctcgggttcggcaagcgcaag
gagcagaacgcagtgatcctggcccggctgggcgaattgaatccgctggacctcccgatt
atggtggggccgtcgcgcaagagttttctggctcatcccgatctggaagagacgaagttc
gcaacggcggcggcggtaactgccgcgattctcggcggcgctcacatcgtgcgtgtgcac
gacgtccgcgagatgcgcgcggtggcggacgtggcggatgagatcgtacgcggcaggccc
gagtag

DBGET integrated database retrieval system