KEGG   Candidatus Solibacter usitatus: Acid_6708Help
Entry
Acid_6708         CDS       T00412                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acid_6708
Enzymes [BR:sus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Acid_6708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8408907..8409752
Genome map
AA seq 281 aa AA seqDB search
MRKLFFWKLKQHEIRLGERTVLMGVLNVTPDSFSDGGKYSDPDRAFARAIELEEQGADII
DIGAESTKPGSTRVSVAEEMRRLIPVLKRLKDRLGIPISVDTYKAEVAERALELGVEIIN
DPSGLTFEPQLARTAANMNAGLILNHMRGTPETWAKLGPMPDPLSTIGRDLDAMISRARH
AGVDKAHMVIDPGLGFGKRKEQNAVILARLGELNPLDLPIMVGPSRKSFLAHPDLEETKF
ATAAAVTAAILGGAHIVRVHDVREMRAVADVADEIVRGRPE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaactctttttttggaaattgaagcagcacgagatccgcctgggcgaacgcacc
gtgctgatgggcgtgctcaatgtaacgcccgattcgttttccgatgggggcaagtactcg
gacccggaccgcgctttcgcgcgggcgatcgagctggaggaacagggcgcggacatcatc
gatatcggcgcggaatccaccaagccggggtccacgcgagtatcggtggccgaggagatg
cgccggctgatcccggtgctgaagcggttgaaggaccggctgggcattccgatctcggtg
gacacatacaaggccgaggtggccgagcgcgcgctagagctgggcgtggagatcatcaac
gacccttcgggactgacgttcgaaccgcagctggcgcggaccgcggccaacatgaatgcc
ggattgattttgaatcacatgcgcgggacgccggagacatgggcgaagctgggtccgatg
ccggatccgctctcgacgatcgggcgcgatctggatgcgatgatcagccgggcgcggcac
gcgggcgtggacaaggcccacatggtgatcgatccgggcctcgggttcggcaagcgcaag
gagcagaacgcagtgatcctggcccggctgggcgaattgaatccgctggacctcccgatt
atggtggggccgtcgcgcaagagttttctggctcatcccgatctggaagagacgaagttc
gcaacggcggcggcggtaactgccgcgattctcggcggcgctcacatcgtgcgtgtgcac
gacgtccgcgagatgcgcgcggtggcggacgtggcggatgagatcgtacgcggcaggccc
gagtag

DBGET integrated database retrieval system