KEGG   Candidatus Solibacter usitatus: Acid_6985Help
Entry
Acid_6985         CDS       T00412                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acid_6985
Enzymes [BR:sus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Acid_6985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8773491..8774435
Genome map
AA seq 314 aa AA seqDB search
MRRQPRIVVIGSANIDLVTYTDQFPRPGETIFGREFSLGFGGKGANQAVAARLCGAEVAM
VARVGDDLFGPANIQNFTSRGIDVRHVMTTAGVSSGVAPIFVESSGQNRIWVVKGANDRL
LPADVAAASDVLAGADFLVMQLEIPTETVYYALRFARERGIRTILNPAPGQALDLAQIAS
ADYVIPNETEAEALAGTPVHALEDAQRCAQKLLDGGLRRVIVTLGANGALLATHDGMHHV
APFPVQPIDTTGAGDAFIGSFACFCAEGFDELAAIARANLYAALSTLGPGTQKSFVSRER
FNTEWAARSVSVTP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagacgacagccgcggattgtggtgatcggcagcgcaaacatcgacctggtcacttac
accgaccagttcccgcgtcccggagaaaccatattcggccgcgaattcagcctcggcttc
ggcggcaaaggcgccaaccaggccgtcgcggcccgactctgcggcgccgaggtggcgatg
gtggctcgcgtcggcgacgatctcttcggccccgccaacatccagaacttcacctcgcgc
ggcatcgacgtccgccacgtcatgaccaccgccggcgtctccagcggcgtcgcgcccatc
ttcgtcgaaagctccggccagaaccgcatctgggtcgtcaaaggcgccaacgaccggctc
ctccccgccgacgtcgccgccgcttcagacgtcctcgccggcgccgacttcctggtcatg
cagctcgaaatccccaccgagaccgtctactacgctctccgcttcgcccgcgagcgcggc
atccgcaccatcctgaatcccgcccccggccaggcgctcgacctcgcccaaatcgcctcc
gccgattacgtcattcccaacgagaccgaagccgaagctctcgccggcacccccgtgcat
gccctcgaagacgcgcagcgctgtgcccagaagctgctcgatggtggattgcgccgcgtg
atcgtgaccctcggcgccaacggcgcgctgctcgccacccacgatggcatgcaccacgtc
gcgcccttccctgtccagcccatcgataccaccggcgccggcgacgccttcatcggcagc
ttcgcctgcttctgcgccgagggcttcgacgaactcgccgccatcgcccgcgccaatctt
tacgcggccctctccaccctcggccccggcacccaaaaatccttcgtctcccgcgaacgc
ttcaacaccgagtgggccgcccgctcagtctccgtaactccctga

DBGET integrated database retrieval system