KEGG   Candidatus Solibacter usitatus: Acid_7335Help
Entry
Acid_7335         CDS       T00412                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid_7335
Enzymes [BR:sus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Acid_7335
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid_7335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9209848..9212022
Genome map
AA seq 724 aa AA seqDB search
MTGEEIEAIVNGYHGDAFGILGPHSVRKKNGNPRWEVRAFLPQADSAVVLAGTTRYDMEK
RHTQGFFVAAMDGDSVPYVIRARLWDGREIEIVDPYRFGPQISDSDLYLHTEGTLNEAWR
SLGAHLVTTEGASGVRFAVWAPNAENVTVAGEFNDWDVRRHPMRRRNGGVWELFIPGLTQ
GTAYKYNIRSRFAGYQQLKADPYAFYCEHPPKSASVVWGLDNYQWQDQEWMETRAAHDLL
KSPMAVYEVHLGSWMRGPMGQVLTYRDLAVKLVEYVKQMGYTHVELLPPMEHPFSGSWGY
QIIGYFAPTSRFGTPDDFKFFIDAFHRAGIGVIVDWVPAHFPKDAHGLVFFDGTALYEHA
DPRKGEQQDWGTLVFNYGRNEVRTFLISNALFWLKEMHIDGLRVDAVASMLYLDYSRKAG
EWIPNQYGGNENLEAIDFLRQFNVVAHSVPGAFTVAEESTAFAGVSKPVYLNGLGFTMKW
NMGWMHDMLDYFSNDPIYRKYHHNSITFSLLYAFTENFVLPVSHDEVVHGKGSLLNKMPG
DEWRQFANARAFLAYMWVHPGKKLLFMGQEIGQREEWNHDQGIRWELLQFDLHRQLQSLM
RELNRVYKANPALYEIDFHYTGFEWVDFHDGANSIIAFLRRAEDPDDFILVCCNFTPVPR
QGYEFGVPEEGFYQEILNTDSEYFGGTNMGNGGCLSSRPIAKHNRSHSIAVTLPPLAVVA
FKKC
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactggtgaagaaatagaagccatagtcaatggctatcacggggacgccttcggcatc
ctgggaccgcattcggttcgcaagaaaaacggcaatccgcgctgggaagtgcgcgcgttc
ctcccgcaggcggattccgccgtcgtgctggctggaaccacccgctacgatatggagaag
cggcacacgcaaggcttcttcgtcgccgccatggatggcgactccgtgccttacgtcatc
cgcgcgcgtctctgggatggccgcgagatcgagatcgtcgacccctatcgcttcggcccg
cagatctccgattccgatctctacctgcacaccgagggcaccctcaacgaggcctggcgt
tcgctcggcgcccacctcgtcaccaccgaaggcgcctccggcgtgcgcttcgccgtctgg
gcgcccaacgccgagaacgtcaccgtcgccggcgagttcaacgattgggatgtccgccgc
caccccatgcggcgccgcaacggcggagtctgggagctcttcatccctgggctcacgcag
ggcaccgcctacaagtacaacatccgttcgcgcttcgccggctatcagcaattgaaagcc
gacccgtacgccttctattgcgaacatcccccgaaatccgcctccgtggtctggggcctc
gacaactatcagtggcaagaccaggagtggatggagacccgcgccgcgcacgacctgctg
aaatcgccgatggcggtctacgaggtccatctcggcagctggatgcgcggacccatgggc
caggtgctcacgtaccgcgatctcgccgtcaaactggtcgagtacgtcaagcagatgggc
tacacccatgtcgaactgctcccgcccatggagcaccccttcagcggatcctggggatat
cagatcatcggctacttcgcccccacctcgcgcttcggcaccccagacgatttcaagttt
ttcattgatgccttccaccgcgccggcatcggcgtcatcgtcgattgggtgcccgcccac
ttcccgaaagatgcccatggcctggtcttcttcgatggcaccgcgctctacgaacatgcc
gacccgcgcaaaggcgagcagcaggattggggaacgctcgtcttcaactacggccgcaac
gaagtccgcacctttctcatctccaacgcgcttttttggctcaaggagatgcacatcgat
ggcctgcgcgtggatgccgtcgcttccatgctctacctcgattactcgcgcaaggccggc
gagtggatccccaaccagtacggcgggaacgagaatctcgaggccatcgatttcctccgc
cagttcaatgtggtcgctcactccgtgcccggcgccttcacggtcgccgaggaatccacc
gccttcgccggcgtctccaaacccgtctacctcaacggcctcggcttcaccatgaagtgg
aacatgggctggatgcacgacatgctggactacttcagcaacgaccccatctatcgcaag
taccaccacaacagcatcaccttcagcctgctctacgccttcacggaaaatttcgtcctc
cccgtctcccacgacgaagtggtccacggcaagggttcgctcttaaataagatgcctggc
gacgagtggcgccagttcgccaacgcccgcgccttccttgcctacatgtgggtgcatccc
ggcaagaaactgctcttcatgggccaggaaatcggacagcgcgaagagtggaatcacgat
cagggtatccgctgggagctgcttcaattcgatctccaccgccagttgcagagcctgatg
cgcgagctcaatcgcgtctacaaggcgaaccccgcactctacgaaatcgacttccattac
accggcttcgaatgggtggatttccacgatggcgccaactcgatcatcgctttcctgcgc
cgcgccgaagacccggacgatttcatcctcgtctgctgcaacttcactcccgttccccgc
cagggctacgagttcggcgtccccgaagaaggcttctatcaggagatcctgaataccgat
tcggagtacttcggcggcaccaacatgggcaacggcggctgcctctccagccgtcccatc
gccaaacacaaccgctctcactcgatcgccgtgaccctccccccgctcgcagtggtagcc
ttcaaaaaatgttag

DBGET integrated database retrieval system