KEGG   Candidatus Solibacter usitatus: Acid_7349Help
Entry
Acid_7349         CDS       T00412                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sus  Candidatus Solibacter usitatus
Brite
Enzymes [BR:sus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Acid_7349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9226040..9226654)
Genome map
AA seq 204 aa AA seqDB search
MVETQLRRRGIRDQRVLAAMLQIPREQFVSPETRLLAYSDEPLQIGFGQTISQPYMTALM
AQELGLQGGESVLEVGAGCGYAAAVLGALAAYVITVEIIPGLAALAERNLLRTGLAGNVR
VVPGDGSWGYAAGAPYDAISVAAGAPDIPLALMQQLNDPGILIIPVGDFKDQELRVLRKR
DGRVEQSVATLCRFVPLRGGEGWH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaacgcaacttcgccggcgcggcatccgcgaccagcgggtgctggcggccatg
ctgcaaatcccgcgcgaacagttcgtttcgccggagacccggttgctggcatatagcgac
gaaccccttcaaatcggcttcggccagaccatctcgcaaccctacatgacggcgctaatg
gcgcaggagcttgggttacaggggggtgaaagcgtgctcgaagtaggtgccggctgcggc
tatgcggcggccgtgctgggagcgctcgcggcatacgtgatcacggtcgagatcataccc
ggactggcggcactggcggagcgtaacctcttgcgaacggggctggcgggcaatgtccgc
gtggtcccgggcgatggttcctggggttacgccgcgggcgcgccatatgatgccatttcg
gtggcggcgggcgcccccgatattcctctggcgctgatgcagcagctcaacgatcccggg
atcctgataattccggtcggcgatttcaaggatcaggaattgcgggtgcttcgcaagcgc
gacgggcgagtggaacagagcgtggctacgctctgccgttttgtcccgctgcgcggcggc
gaaggctggcactag

DBGET integrated database retrieval system