KEGG   Candidatus Solibacter usitatus: Acid_7597Help
Entry
Acid_7597         CDS       T00412                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sus00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sus00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sus00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9526398..9528563)
Genome map
AA seq 721 aa AA seqDB search
MTRIASTRAGMLFVALLTLCMRAQEKALPAPVFPFGAVYFRKSNPPEQDWERDHKTAAHM
GINIFRHWFMWASIENSPGKYDWRDYDRMVELEGQNGIKVVIAELVNTAPEWMWDRYPNA
RHTGPDGQQSFPTVGSGSATGGAPLCLDNEEVRAQAGKFLTALVERYRNHPATLGYDVWN
EGSVQECFCPATQAKFREWLKTKYGTLEALERAWHRYSLGDWESVHPPHGTGGYPDSLDW
LAFRRDDAIRLLHWRTELIRGLDKRNKVTAHGVGALTEIEWRTVDDVDSYGYTWVASRHT
NDPWMQFQAADLVRGAARGKPFWHAEATGGPLWMQPQVQNRPLEDGRSSDDKDIRVWSLI
DMAAGASGILFTRWRPLLDGPLFGAFGPMGMDGSMTPQGEMSGVLARWTNSHTGVWKSRP
VKGDVGIVFVQESDDFNAVQSGSAGGESARGTRGVAAMGAYTESVQGAYQAFFDSNIQPD
FVGIDDIGLYPMIYLPYPEMLKQSTADKLRDFVAKGGKLVSEGCPGYFGDGGTAGTVQPN
LGLDKLFGARETYVQFTPDLLTKLKLTVRGKEIGGQYFLQEYKAVGGQAAGQYANGHIAA
VENSFGAGKTLLIGSFPGGGYFRARSPATREFFAGLLTWAGVEQQVQSSDVDVKARLHKG
EGGTYLWVVNPTRTTRTVKITLPSAFQRVVDLWQESAHPTITGNVVVTTVGDRNAAVIRL
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaatcgcctcgacccgtgccggcatgctgttcgtcgctctcctgaccctttgc
atgagagcccaggaaaaggcgctgcctgccccggtgtttccgttcggcgcagtgtatttt
cgcaaatcaaacccgcccgagcaggattgggagcgggatcacaaaactgcggcgcatatg
ggcatcaacattttccgtcattggtttatgtgggcgtcgattgagaattcgcctggcaaa
tatgactggcgggactatgaccggatggtcgaactggaaggacagaacgggatcaaagtg
gtgatcgccgaactggtcaacactgcgccggagtggatgtgggacaggtatccgaacgcg
cgacatacaggcccggacgggcagcagagctttccgaccgtcggcagcggcagcgcaact
ggcggtgcgccgctctgtctggataacgaggaagttcgcgcacaggccggaaagtttctt
actgcgctggtggagcgttatcgcaatcatcctgcgacgctaggctacgacgtgtggaac
gagggcagcgtacaggagtgcttttgcccggccacacaggccaagttccgtgagtggctg
aagacgaagtacggaacattggaggcgctggagcgcgcctggcaccgttacagcctggga
gactgggaatccgtgcatccgccgcacggtacgggaggatatcccgattcgctcgactgg
ctggcatttcgccgcgacgatgcaattcggctgctccactggcgcacggagttgatccgc
ggccttgataagcgaaacaaggtcacggcgcatggggtgggtgcgcttaccgaaatcgag
tggcgtaccgtggacgatgtggattcgtacggttacacgtgggtggcgtcacggcatacc
aacgatccatggatgcagtttcaggcggccgacctggtgcgcggcgcggcgcgagggaaa
ccgttctggcatgcggaagccaccggcggacccttgtggatgcagccacaggtgcagaac
cggccgctggaagacgggcgcagttccgatgacaaagatatccgtgtatggagcttgatc
gatatggccgccggcgcgagtggaatcctgttcacgcggtggcgtccactgcttgacggc
ccgctgttcggcgcgttcggacccatggggatggatgggtcgatgacaccgcagggagag
atgagcggtgtgttagcgcgctggacgaactcgcacactggcgtctggaagtcgcggccg
gtgaagggagacgtggggatcgtgttcgttcaggagtcggacgacttcaatgcggtgcaa
agcggcagcgcgggtggcgagagtgcgcgtggcactcgcggcgtggcggccatgggcgcc
tacaccgagtcggtacaaggggcataccaggcattcttcgattcgaatattcaacccgat
tttgtaggtatcgatgatatcgggttgtatccgatgatctatctgccgtacccggagatg
ctaaagcaatcgaccgccgacaagttgcgggatttcgtggccaagggcggcaagttggtg
agcgagggctgcccgggatatttcggggatggcggcacggcgggcacggtgcagccgaat
ctgggactcgacaagttgttcggagcgcgcgagacgtatgtacagttcacgccggactta
ttaaccaaactaaagctgacagtcagagggaaggaaatcgggggccagtactttttgcag
gagtacaaggcagtaggcggccaggcggcggggcaatatgccaacgggcacattgcggca
gtggagaattcgtttggagcgggcaagactttattgatcggcagttttccgggtggcggg
tactttcgcgcccgctcgccggcaacgcgggaattctttgcgggtcttttaacgtgggcc
ggcgtcgaacagcaggtgcagtcgagtgacgtggatgtgaaggctcggctgcataaagga
gagggcgggacttatctttgggtggtgaatccgacgcggacaacgcgcacggtgaagatc
acgttgccgtcggcgtttcagcgggtggtggacctgtggcaggaatctgcgcacccgacg
atcaccggaaatgtcgtggttacgacggtgggcgataggaacgcggccgtgattcgattg
gactag

DBGET integrated database retrieval system