KEGG   Candidatus Solibacter usitatus: Acid_7771Help
Entry
Acid_7771         CDS       T00412                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid_7771
   00500 Starch and sucrose metabolism
    Acid_7771
Enzymes [BR:sus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Acid_7771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9753800..9754771)
Genome map
AA seq 323 aa AA seqDB search
MRALLLLTAIASAFAQPKAVTVAGDSSGDFTTVGAAIESGAKVIRIKPGTYRELLNITQK
GIQLRGAGTGPQDVVLTYDNSAGTAGGTTKSASITVSGDDFYAENLTMENSFSRTRPLKQ
EGSQAVALKITGDRAVFRRVRFLGYQDTLYANSRRCESEKGPCEPARQYFSECYIEGNVD
FIFGDALAFFDRCEIHALAHSVIMLTAQSRHYAEEKSGYVFDHCRITAEKGADRVYLGRP
WRAYSTVVFLNTEMPAQLDPEGWHEWEHDGKPSLPTSFYAEYRSQGPGAHPESRKQLTAA
EAAGFALKTFLAGDDHWDPTQVH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctactgttgaccgcgatcgcgtcggccttcgcgcaaccgaaggccgtc
acggtggcgggtgattcctcgggcgatttcacgacggtcggggcagcgattgaatcgggc
gcgaaggtgatccggatcaagccggggacctaccgcgaactgctcaacattacgcaaaag
gggattcaactgcgcggcgccgggacgggtccgcaagatgtggttctgacgtacgacaac
agcgccgggaccgcgggaggcaccaccaaatcggccagcatcacggtgtcgggcgacgat
ttctacgccgagaatctgaccatggaaaacagtttctcgcgcacgcgtccgctcaagcag
gagggttcgcaggcggtcgcgctcaagatcacgggcgaccgcgcggtctttcgcagggtg
cgctttctggggtaccaggacaccttatacgccaacagccggcggtgtgaatccgaaaag
ggtccatgcgaaccggcccgccagtatttctcggagtgctacatcgagggcaatgtcgat
ttcatcttcggcgatgcgctggcgtttttcgaccggtgcgaaattcacgcactggcccac
tctgtgatcatgctgacggcgcaaagccggcactatgcggaggagaagagcggctatgtt
ttcgatcactgccgcatcacggccgagaagggcgcggacagggtctacctgggacggccg
tggcgcgcgtactccacggtggtgttcctgaataccgagatgccggctcagctcgacccc
gaagggtggcatgagtgggagcacgatggaaagccctcgctgcccacatcgttctatgcc
gaataccgctcgcagggtccaggcgcgcatcctgagagccgcaagcaacttaccgccgcc
gaagctgccggctttgccctcaagactttcctcgcaggagacgaccattgggatcccaca
caggtacattga

DBGET integrated database retrieval system