KEGG   Candidatus Solibacter usitatus: Acid_7846Help
Entry
Acid_7846         CDS       T00412                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_7846
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_7846
   00620 Pyruvate metabolism
    Acid_7846
   00640 Propanoate metabolism
    Acid_7846
  Energy metabolism
   00680 Methane metabolism
    Acid_7846
Enzymes [BR:sus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Acid_7846
Lipid biosynthesis proteins [BR:sus01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Acid_7846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9842029..9843861
Genome map
AA seq 610 aa AA seqDB search
MDGKMIWTPTREFVETTNVWRLMKRLGFDDREEFLRFSRENPERFWGEMMREMRVEWFTP
YSKELDLSGGPEWARWFIGGRLNIAHNCLDRWADSDCAACIWEGESGAGGTLTFRELREQ
ANRTANGLRALGLEAGDRVALCLPMTPEILPILYGCFKAGLTVVPIFAGFGTGAIATRLI
DSGACVLFTAEFLERRGKRIPLAAKMPEFAGRTIVLGSEWQEFLASQPAEFATESLEAEA
RAFILYTSGTTGKPKGTVHTHAGSLAQMGKEIWLGFDHREGERFFWLSDIGWMMGPWTIL
GNHLFGGTIFLYDGAPDYPGPMRLWETIDRHRITTFGVSPTAIRVLRKSPGELPAMESLR
LLGSTGEPWDDASWLWFFERVGRRRCPIINISGGTEIVGSFLFPLPIQALKPSSLGGPAP
GMSTEVVDESGVPVRGRKGYLVCTRPAPSMTRGIWGDPERYIETYWSKFPGMWYHGDWAS
VDEDGHWFLHGRADESMNVAGRKVGPAEVEEAMMQHPDVAEAAVIGVPDELKGETIVGFA
VAKAGTVLDAAAVVRTVVEVLGPTFRPREIVVVTELPKTQSGKIVRRLIRQKYLGEELGD
LSTVANPWAL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaagatgatctggactccgactcgggaatttgtggagaccacgaacgtatgg
cgattgatgaagcgcctggggtttgacgaccgcgaagagttcctgcgtttctcacgcgag
aatccggagcgattctggggcgagatgatgcgtgaaatgcgtgtggagtggttcacgcct
tactcgaaagagctagacctctcgggcggcccggaatgggcgcgctggttcatcggcggg
cgtttgaacatcgcgcataattgcctcgaccgctgggcggacagcgattgcgcggcttgt
atctgggagggcgagagcggcgcgggcggcacattgacattccgcgaactccgcgagcag
gccaatcgcacggcgaacgggctgcgggcgctcggtctggaagcgggcgaccgggtagcg
ctgtgtctgccgatgacgccggagatcctgccgattctctatggatgcttcaaggccggg
ctcacggtggtgccgattttcgcgggtttcggcaccggcgcgattgcgacgcggttgatt
gactcgggcgcatgcgtgttgttcacggcggaatttttggagcggcgcggcaagcggatt
ccgctggcggccaagatgccggagttcgctggaaggactatcgtgctgggcagcgagtgg
caggaattcctggcgagtcagccggcggagttcgcgacggaatcactggaggcggaggct
cgcgccttcatcctgtatacttcggggaccacgggcaagccgaagggcacggtgcacacg
cacgcgggatcgctggctcagatggggaaggagatctggctgggcttcgatcatcgagaa
ggggagcggtttttctggctgagcgacatcggctggatgatgggaccgtggaccattctg
gggaaccacctgttcggcggcacgatttttctatacgacggcgcgcccgattatccgggg
ccgatgcggttatgggagacgatcgaccggcaccggatcacgacgttcggagtttcgccg
accgcgatccgcgtcctccggaaatcgccgggcgagctgccggcgatggagtcgctgcgg
ctgctgggctcgactggggagccttgggacgatgcctcgtggctgtggtttttcgagcga
gtgggccggaggcgctgcccgatcatcaacatttcaggcggcaccgagatcgtgggcagc
ttcctgtttccactgccgattcaggcgttgaaaccaagcagcctgggcggtccggcgcca
ggcatgtccacggaggtggtggacgagagcggagttccggtgcgtgggcgcaagggctac
ctggtgtgcacgcggccggcgccttccatgacgcgggggatctggggcgacccggagagg
tacatcgagacgtattggagcaagttcccgggcatgtggtatcacggcgattgggctagc
gtggatgaagacggccactggtttcttcacgggcgcgccgacgaatcgatgaacgtagcg
ggacggaaggtgggtccagcggaggtcgaagaggcgatgatgcagcatccggacgtggcg
gaggcagcggtgatcggcgtcccggacgagttgaagggcgagaccatcgtgggcttcgcg
gtggcgaaggcggggactgttttggatgcagcggcggtggtcaggactgtggtagaagtg
ctcggccctacgttccggccgcgcgagatcgtggtggtgacggagttgccgaagacgcag
agcgggaagatcgtgcggcgtttaattcgccagaagtatctgggagaagagctgggagat
ctctcgaccgtggcgaatccgtgggctttgtga

DBGET integrated database retrieval system