KEGG   Candidatus Solibacter usitatus: Acid_7887Help
Entry
Acid_7887         CDS       T00412                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acid_7887
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_7887
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acid_7887
Enzymes [BR:sus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acid_7887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(9891470..9892273)
Genome map
AA seq 267 aa AA seqDB search
MTRIGRLFDCLKRENRKALIAYLTAGDPTPDHTPGLVEALVRGGADLIELGVPFTDPIAD
GPVIQRAGERALKAGTTLASVLEIARKIRETSEVPLLLFTYLNPVLRYGLDRLGADAAAA
GIDGCLLTDASVEEAESYVAAMHKHGLDTVFLAAPTSTARRIELVARYSTGFVYLVSRTG
VTGERESLSASVAPLIQAVRAATDLPLAVGFGISKPEHVAELGSQVEAVVVGSAFVRLIE
QNAESAALEIQLESFTRELKRGFGARA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtatcggacgccttttcgactgtttgaagcgggagaaccgcaaggctctgatc
gcgtacctgacggcgggcgatccgacgccggatcacacgccggggctagtggaagcgctg
gtgcgcggcggggcggatttgatcgagctgggcgttccgttcaccgatccgattgcggac
ggcccggtgatccagcgggcgggcgagcgcgcgctcaaagcggggacgaccctggccagc
gtgctcgagatcgcgcgcaagatccgggaaacgtcagaggtaccgctactgttgttcacg
tatctcaatccggtgctgcggtatgggctcgaccggctgggagcagatgcggccgcggcg
ggaatcgacggctgcctgctgacggacgcgagcgtggaagaggcggagagctatgtggcg
gcaatgcataagcacgggctcgacacagttttcctggcggcaccgacgagcacggcgcgg
cgcatcgagctggtggcgcggtactcgacgggttttgtttatctggtatcgcggacgggt
gtgacgggggagcgcgaatcgctctcggcgtcggtggcgccgttgattcaggcggtgcgc
gcggcgactgatttgcctctggcagtgggcttcgggatttcgaagccagagcacgtggcg
gagctggggagccaggtggaagcggtggtggtgggcagcgcgttcgtgcggctgatcgag
cagaacgcggagagcgccgcgctggaaatccaactggaaagtttcacgcgcgaattgaaa
cgcggttttggagccagggcatga

DBGET integrated database retrieval system