KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00263Help
Entry
SAT0131_00263     CDS       T01888                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAT0131_00263
Enzymes [BR:sut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAT0131_00263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(285420..286334)
Genome map
AA seq 304 aa AA seqDB search
MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGTDGVADFILEDFKAAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMT
PEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLI
DIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLITLGKQGTYFATKNQSQHIE
AYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEE
VNQV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaagttgttattttaggttcaacgaatgtcgatcaatttttaacagttgaa
agatatgcacaaccaggcgaaacattacatgttgaagaagcacaaaaagcattcggcgga
ggtaaaggtgccaaccaggctattgccactgcacgcatgcaagcagacacaacatttatt
actaaaattggcactgatggcgttgctgatttcatcttagaagattttaaagcggctcat
attgatacgtcatatattatcaaaacagctgaagcaaaaacgggccaagcctttatcact
gtgaatgcagaaggacaaaacaccatctatgtttatggtggtgcgaatatgacgatgaca
cctgaagatgttattaacgcaaaagacgctataatcaatgcagactttgtcgttgcacaa
ttagaagtacccatcccggctattatatctgcatttgaaattgccaaggcacatggtgtg
acgactgtattaaatcctgcaccagcgaaagcattacctaatgaattattgtcattaatc
gatattattgtgccaaacgaaacagaagccgaattgttatctgggattaaagtaacaaat
gaacaatctatgaaagacaatgccaattactttttatctttaggcattaagactgttttg
attacgctaggtaagcaaggtacatattttgctactaaaaatcaaagccaacacatcgaa
gcttataaagtaaatgcgattgatacaactgctgcaggcgacacatttattggtgcattt
gtcagtcgcttaaacaagtcgcaagataacttagcagatgctattgattttggtaataaa
gcgagctcactcactgtacaaaaacacggcgcgcaagcatctattcctctactagaagaa
gtaaatcaagtttaa

DBGET integrated database retrieval system