KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00408Help
Entry
SAT0131_00408     CDS       T01888                                 

Gene name
ald2
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAT0131_00408 (ald2)
   01230 Biosynthesis of amino acids
    SAT0131_00408 (ald2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAT0131_00408 (ald2)
  Energy metabolism
   00680 Methane metabolism
    SAT0131_00408 (ald2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAT0131_00408 (ald2)
Enzymes [BR:sut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAT0131_00408 (ald2)
Exosome [BR:sut04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAT0131_00408 (ald2)
  Exosomal proteins of melanoma cells
   SAT0131_00408 (ald2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
407298..407879
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSRAEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatattgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggcagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system