KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00495Help
Entry
SAT0131_00495     CDS       T01888                                 

Definition
S33 family peptidase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Brite
Enzymes [BR:sut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAT0131_00495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492866..493600
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcgtatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttattgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcaacactatcctttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgacgatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
atgccagctaatatattatttggtggtaaagatgcgccatcctatgaaacaagtgcacat
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcgcat
catttaatgacgcatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system