KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00521Help
Entry
SAT0131_00521     CDS       T01888                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sut00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAT0131_00521
DNA repair and recombination proteins [BR:sut03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAT0131_00521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520605..521201
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaaacttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaagagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggcattggaccagaa
gatattaatattccttcattgattgaacgcttgaaaaacgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagccatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaacattatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system