KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00561Help
Entry
SAT0131_00561     CDS       T01888                                 

Definition
Dihydropteroate synthase chain A synthetase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sut00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560878..561687
Genome map
AA seq 269 aa AA seqDB search
MTKTKIMGILNVTPDSLSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSL
EEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKEKENENARHNLS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcactctcagatggt
ggaaaatttaataatgttgaatcagctataaatagagtgaaagccatgatagatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggtcatgaaatggtttcatta
gaagaagagatgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atgattaatgatcaatgggcgggtctgtatgatcatcgtatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaaggag
aatgaaaatgcaagacacaatctttcttaa

DBGET integrated database retrieval system