KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00852Help
Entry
SAT0131_00852     CDS       T01888                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Brite
Enzymes [BR:sut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAT0131_00852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857860..858600
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcatatgcaccgcaatatgaaggccacgcggcaccaccagatgaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gaaggtaaagatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagagcaagttgatgaagtgttggat
cctattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaaaatatcaagtggtacagtgaatctggacat
gttattacgattgataaagagaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system