KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01258Help
Entry
SAT0131_01258     CDS       T01888                                 

Gene name
moaE
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAT0131_01258 (moaE)
Enzymes [BR:sut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SAT0131_01258 (moaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1237277..1237900
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcaggaccatctggagtaggtaaaggt
actgttagaaaacgaatatttgaagatccaagtacatcatataagtattctatttcaatg
acaacacgtcaaatgcgtgaaggtgaagttgatggcgtagattacttttttaaaactagg
gatgcgtttgaagctttaatcaaagatgaccaatttatagaatatgctgaatatgtaggc
aactattatggtacaccagttcaatatgttaaagatacaatggacgaaggtcatgatgta
tttttagaaattgaagtagaaggtgcaaagcaagttagaaagaaatttccagatgcgcta
tttattttcttagcacctccaagtttagaacacttgagagagcgattagtaggtagagga
acagaatctgatgagaaaatacaaagtcgtattaacgaagcgcgtaaagaagttgaaatg
atgaatttatacgattacgttgtagttaatgatgaagtagaacttgcgaagaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatagaaaa
atgattttggaggctaaaaaataa

DBGET integrated database retrieval system