KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01361Help
Entry
SAT0131_01361     CDS       T01888                                 

Definition
Glutathione peroxidase -like protein BsaA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAT0131_01361
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAT0131_01361
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAT0131_01361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1349493..1349969)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataagggtgacgttatgctaattgttaatacagctagcgaatgtggctttacttca
caatttgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggccaagaacctggttcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacacggattctttaatgag
aaaatcaaatggaatttcactaagtttttagtggatcgcgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaaattattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system