KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01442Help
Entry
SAT0131_01442     CDS       T01888                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAT0131_01442
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAT0131_01442
Enzymes [BR:sut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAT0131_01442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1425142..1425924
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttatcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaccaatatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacgacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatctgataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgttacaaatgtggaacatacaaatact
attttagaaaataaaaaaacaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system