KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01445Help
Entry
SAT0131_01445     CDS       T01888                                 

Gene name
hlgC
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sut01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sut00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sut00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427756..1428484
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIITDLPYELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggagtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattactgatttaccatatgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatcccatgcggaaggctttatttatactgtgacgatg
aatgcgacaacagggcaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggcattgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaggaaatcattaaatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system