KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01490Help
Entry
SAT0131_01490     CDS       T01888                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAT0131_01490
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAT0131_01490
  Amino acid metabolism
   00310 Lysine degradation
    SAT0131_01490
Enzymes [BR:sut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAT0131_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467648..1468916)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctatcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgaagaaacaaataat
aaaaaagaagaaacaacaaataattcggtagataaagctgaagtaaatcaagcaaatgat
gacaatcagcaacgtattaatgctacgccttctgcgcgtcgatatgctcgtgaaaatggt
gtgaatcttgctgaagtaagtccgaaaacaaatgatgtggttcgtaaagaagatattgat
aagaaacaacaggcaccggcatcaacacaaacaacacaacaagcatctgcaaaagaagag
aaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgtagaaag
aaaacagctgccaaaaaattattagaggtatctaataatacagctatgttaacaacattt
aacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaatttatg
aaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgtagca
gctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacgaaa
caatattatgatattggtgtagctgtttctacagatgatggattattagtaccatttgta
agagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagcagtt
aaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgattaca
aatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagctgca
atcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaagaa
gcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttattatta
gaatcttaa

DBGET integrated database retrieval system