KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01769Help
Entry
SAT0131_01769     CDS       T01888                                 

Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00860  Porphyrin and chlorophyll metabolism
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAT0131_01769
Enzymes [BR:sut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SAT0131_01769
Exosome [BR:sut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAT0131_01769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD HMA
Motif
Other DBs
NCBI-ProteinID: AEB88755
Position
complement(1747876..1748850)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSATMRDMVRENHVRKEDLIYPIFVVEKDDVKKEIKSLPGVYQISLNLLE
SELKEAYDLGIRAIMFFGVPNSKDDIGTGAYIHDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRRGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNVPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattgagatcatcagcgacaatgagagatatggttaga
gagaatcatgtaagaaaagaagatttaatatatccaatttttgtagttgaaaaagacgat
gtgaaaaaagaaattaagtcattgccaggtgtataccaaatcagtttgaatttacttgaa
agtgaattaaaagaagcttatgacttaggcatacgtgccattatgtttttcggtgttcca
aactcaaaagatgatataggtactggtgcatacattcacgatggtgttattcaacaggca
acacgtattgctaaaaaaatgtatgatgacttattaattgttgcagacacttgtttatgt
gaatatactgatcatggtcattgtggcgtgattgatgaccatacacatgacgttgacaat
gataaatcattgccactacttgttaaaacagcaatttctcaagtggaagctggtgctgat
attattgcgccaagtaatatgatggatggttttgttgctgaaattcgtcgtggattagat
gaagccggctattacaatattcctataatgagttatggtgtcaagtatgcatcaagtttc
tttggaccttttagagatgcagcagattcagcgccatcatttggggatagaaaaacgtat
cagatggaccctgctaaccgtttggaagcacttcgtgaattagaaagtgatcttaaagaa
gggtgcgacatgatgattgttaaacctgctctaagttatttagatatagttcgagatgtt
aaaaatcatacgaatgttccagttgttgcatataatgtgagtggagaatatagtatgact
aaagcagcggcacaaaatggttggatagatgaagaacgtgtcgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattattacgtattttgcaaaggacatttgtcgc
tatttagataaataa

DBGET integrated database retrieval system