KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01770Help
Entry
SAT0131_01770     CDS       T01888                                 

Definition
Uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAT0131_01770
Enzymes [BR:sut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SAT0131_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1748853..1749521)
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccctttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttattttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcgagttgattttatgccaaacgacttttctcaagaaggatttttaaaa
tcatttaatcaaactaaccaaaaaatacttttgccttcgagtgaattggcgagaccattg
ttattagcagcgttatctaaagataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaatcatatcaacaa
ccagtaacaattgcagaaattcaaacactcgaatcactaattgaaaagattttagaaagt
aggggctaa

DBGET integrated database retrieval system