KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02143Help
Entry
SAT0131_02143     CDS       T01888                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAT0131_02143
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAT0131_02143
Enzymes [BR:sut01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAT0131_02143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2110316..2111539
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLYGRGTTDMKGGLMALVVSLIEL
KEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSELKQQDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIIND
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQDEIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaacagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggtcatatcccccttttcaactgacagaaaaagatggcaaattatatggc
cgaggcactacagatatgaaaggcggtttaatggctttggtcgtatctctaatcgaatta
aaagaacaaaatgaattgcctcatggaacgattagattactggctactgctggcgaagag
aaagaacaagaaggtgccaaattattagctgataaaggctatttagacgatgtcgatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaggggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatctatttaaagaaaaatattcagagcttaaa
caacaagatactaaacatgaattagatgttgcgcctatgttcaaatcattgattggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaatgat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaagac
gaaatatttgtttcagcgcttgtaggtgcaacagatgcctctagtttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggcttcc
attcaatatttaaaagaaaaataa

DBGET integrated database retrieval system