KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02890Help
Entry
SAT0131_02890     CDS       T01888                                 

Definition
Alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAT0131_02890
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAT0131_02890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAT0131_02890
Enzymes [BR:sut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAT0131_02890
Exosome [BR:sut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAT0131_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2808529..2809953
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSASYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSADVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gtttttagctctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgatcctcatgctaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggtcataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacggtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggtggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggagttatcaaaatctgataaagataaagtgcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattctaacgatattacaggagtcatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctgcatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaagttaaaaaagagaataaaaagctaaaaagactactt
aaaaaagaaaaagatgaaaaatctgcagatgtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacaggatggacttccgatggacataca
ggcgaagatgttaatacttacgcttatggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

DBGET integrated database retrieval system