KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0138Help
Entry
M013TW_0138       CDS       T01744                                 

Definition
putative alcohol/acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M013TW_0138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_0138
   00620 Pyruvate metabolism
    M013TW_0138
   00650 Butanoate metabolism
    M013TW_0138
  Lipid metabolism
   00071 Fatty acid degradation
    M013TW_0138
  Amino acid metabolism
   00350 Tyrosine metabolism
    M013TW_0138
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M013TW_0138
   00626 Naphthalene degradation
    M013TW_0138
Enzymes [BR:suu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M013TW_0138
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M013TW_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154695..157304
Genome map
AA seq 869 aa AA seqDB search
MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQHMV
LAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDIIQ
WIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAIMN
EQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALVKA
QSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGDMY
NELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIMSL
TTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQPQIKIFSEVEPNPSTNTVYKGLEM
MVDFQPDTIIAFGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENATF
ICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADTGM
DVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGMAF
ANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADTDY
ADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAELAF
EDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggcaattatg
attgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaagtcacaa
gaagaaattgatcatattgttcatcaaatgagtttagcagctgttgatcaacatatggtg
ctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcgattaaa
aatttatacgcttctgaatatatatggaattcaataaaagacaataagacagtagggatt
attggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgttatttgt
ggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgattgcaatt
aagacaggaaatccaattatttttgcattccatccaagtgcgcaagaatcgtcgaagcgt
gcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatattattcag
tggattgaagtaccttctatcgaagcaacaaaacaattaatgaatcacaaaggtattgca
ttagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggtaaaccg
gcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacacattaaa
cgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgtgcttct
gaacaagttgtagtcattgataaagaaatttataaagatgttactaatgaatttaaagca
catcaagcatactttgttaaaaaagatgaattacaacgcttagaaaatgcaattatgaat
gaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaatagctgaa
ttagcaggtatacctgtccccgaaaatacaaaacttatcatagccgaaattagcggtgta
ggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagtaaaagcc
caatctacaaaacaagcatttcaaatttgtgaagacacactacattttggtggattagga
cacacagccgttatccatacagaagatgaaacattacaaaaagattttggactaagaatg
aaagcttgtcgtgtacttgtaaatacaccatcagcggttggaggtattggtgatatgtat
aacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactcaatttca
cataatgttagtgcgacagatttattaaacataaaaacaattgctaaacgacgtaataat
actcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatgagtcta
acaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtcgaattc
ggttatacaaaaacagttgagaatgtattaagacaaagaacggaacagcctcaaattaaa
atatttagcgaagtcgaaccgaatccatcaactaatacagtatataaaggtctggaaatg
atggttgatttccaaccggatacaatcattgcatttggtggtggttcagcgatggatgct
gcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgctaaacaa
aagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcgacgttc
atttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagttatcaca
gatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgatgttgca
attattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagatacaggaatg
gatgtactaacgcatgcaatggaatcatatgtatctgtaatggcttcagattacacaaga
ggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgttgaaaaa
ggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatggcattt
gcaaatgcattcttaggcattgcacactcaattgcgcataaaattggtggggaatatggt
attccgcatggtagagcgaatgcgatattactaccgcatattatccgttataatgccaaa
gacccgcaaaaacatgcattattccctaaatatgagttcttcagagcagatacagattat
gcagatattgccaaattcttaggattaaaaggtaatacgacagaagcactcgtagaatca
ttagctaaagctgtctacgaattaggtcaatcagtcggaattgaaatgaatttgaaatca
caaggtgtgtctgaagaagaattaaatgagtcaattgatagaatggcagagctcgcattt
gaagatcagtgtacaactgctaatcctaaagaagcactaatcagtgaaatcaaagatatc
attcaaacatcatatgattataagcaataa

DBGET integrated database retrieval system