KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0247Help
Entry
M013TW_0247       CDS       T01744                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292589..294025
Genome map
AA seq 478 aa AA seqDB search
MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVNTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattaccgcaaaatttcatgtggggtggcgcacttgccgcaaatcaatttgaa
ggtggatatgataaaggtggcaaaggattaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacagaatctatagatccaaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaaagaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccgaatggggatgaagat
gtgccaaatgaagaaggactcgccttttatgatcgtatctttgatgaattaattgcacaa
ggtattgaacctgttgtgacgttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtccattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattgacagaaaat
gataatcctgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcagttcgtcttggtaaagagattaatccgaagtttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgtttacgtttctttttcccggatgttcaagtgagaggttattatccaagctatgctaaa
aaaatgctggcacgaaaaggatatgatgttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttaatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatatgatcgttatcagttgccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacgccatggggaatcattgatattgtttcatttacaactggtgaaatgaagaaacgc
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgcttgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system