KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0466Help
Entry
M013TW_0466       CDS       T01744                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00900  Terpenoid backbone biosynthesis
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M013TW_0466
Enzymes [BR:suu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M013TW_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEV77551
Position
513185..514033
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFNIGA
SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaaaattaattttacgctcgatacactttttaaaaga
aatgatggctatcatgagattgaaatgataatgacaacagttgatttaaatgatcgttta
acttttcataaaagaaaagatcgaaagatagttgttgagattgaacataattatgtgcct
tctaatcataaaaatctcgcatatcgtgcagcgcaactatttattgagcaatatcaacta
aagcaaggtgtaacaatttctatcgataaagaaatacctgtttctgctggcttagctgga
ggttcggctgatgcagcagcaacgttaagaggattgaatcgactttttaatataggggcg
agtttggaagaattggctctactaggcagtaaaatcgggacagatattccgttttgtatt
tataataaaactgcactatgtactggaagaggagagaaaatcgagtttttaaataaacca
ccttcagcttgggtgattcttgctaaaccaaacttaggcatatcatcaccagatatattt
aagttgattaatttagataagcgttacgacgtacatacgaaaatgtgttatgaggcctta
gaaaatcgagattatcaacaattatgtcaaagtttgtctaatcgattagagccaatttct
gtttcaaaacacccacaaatcgataaattaaaaaataatatgttgaaaagtggtgcagat
ggtgcgttaatgagtggaagcggaccgactgtgtatgggctagcacgaaaagaaagccaa
gcaaaaaatatttataatgcagttaacggttgttgtaatgaagtgtacttagttagacta
ttaggatag

DBGET integrated database retrieval system