KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0486Help
Entry
M013TW_0486       CDS       T01744                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00790  Folate biosynthesis
suu01100  Metabolic pathways
Module
suu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M013TW_0486
Enzymes [BR:suu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     M013TW_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Pox_P35
Motif
Other DBs
NCBI-ProteinID: AEV77571
Position
535087..535890
Genome map
AA seq 267 aa AA seqDB search
MTKTKIMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMVSL
EEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHHMFQVVAN
YDAEIVLMHNGNGEREEPVVEEMLTSLLAQAHQAKMSGVSVDKIWLDPGIGFAKTREEEA
EVMARLDELVATGYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVKAVRV
HNVALNAKLAKGIDFLKENENARHNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcattctcagatggt
ggaaaatttaataatgttgaatcagcagtaactagagtgaaagcgatgatggatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggccatgaaatggtttcatta
gaagaagagctgaacagagtattacctgttgttgaggctattgtcggttttgatgtgaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcttgtttaaagctaggtgttgat
attattaatgatcaatgggcggggctgtatgatcatcatatgttccaagttgtagccaac
tacgatgcggaaattgttttaatgcataatggcaatggcgaacgtgaggaaccagttgtt
gaagaaatgttgacatctttacttgcacaagcccatcaagctaaaatgtcaggtgtttca
gtagataaaatttggctagatccgggaattggttttgccaagacaagagaagaggaagct
gaagtaatggcaaggctggatgaacttgtggccacagggtatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagggat
gaagtgactgctgcaacgacagcgtatggtattatgaagggtgttaaagcagtacgcgta
cataatgttgcgttaaatgctaaattagctaaaggtatagattttttaaaggagaatgaa
aatgcaagacacaatctttcttaa

DBGET integrated database retrieval system