KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0512Help
Entry
M013TW_0512       CDS       T01744                                 

Definition
glutamyl-tRNA(Gln) synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:suu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    M013TW_0512
Enzymes [BR:suu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     M013TW_0512
Amino acid related enzymes [BR:suu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   M013TW_0512
Transfer RNA biogenesis [BR:suu03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    M013TW_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558630..560084
Genome map
AA seq 484 aa AA seqDB search
MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF
DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN
GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSKEEF
IKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEEDL
SWGRKLITLYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVINGEQVPELMTHLFSKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVLNRL
KQYK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgtataagagtaagatatgcaccaagtccaactggttatcttcatattggt
aatgcaagaacagcattattcaattacttgtatgctaaacattataacggagattttgtg
attcgaattgaagatactgataaaaaacgtaatttagaagatggagaaacatcacaattt
gataatcttaaatggttaggattagattgggatgaatctgtagataaagacaatggctac
ggaccatatcgtcaatctgaacgtcaacatatctaccaaccattaatagatcagttacta
gcagaagataaagcatataaatgctatatgacagaagaagaattagaagctgaacgtgaa
gcgcaaatcgctcgtggtgaaatgcctcgctatggtggtcaacatgcgcatttgactgaa
gaacaacgtcaacaatttgaagcagaaggacgccaaccatcaattcgtttccgagtacct
caaaaccaaacgtattcttttgatgatatggtaaaagggaatatttcatttgattcaaat
ggtattggtgactgggttatcgttaaaaaagatggcattccaacgtacaattttgcagta
gctatagatgatcattacatggaaatttcagatgttattcgtggtgatgatcatatttca
aacacgcctaaacaaattatgatttatgaagcatttggctgggagccacctcgttttggt
catatgtcattaattgttaatgaagaacgtaaaaagttaagtaaacgtgatgggcaaatt
ttacaatttattgagcaatatcgtgacttaggttatttacctgaagcgttatttaatttt
attgcgttattaggttggtctcctgaaggtgaagaagaaatcttttctaaagaagaattt
atcaaaatctttgatgaaaagcgtttgtcaaaatcaccagcatttttcgataagcaaaaa
ttagcatgggttaataaccaatatatgaaacaaaaagatactgaaacagtattccaatta
gcattacctcatttaattaaagcgaatttgattcctgaggtgccgtcagaagaggattta
tcttggggacgcaaattaattacgctttatcaaaaagaaatgagttatgccggtgaaatt
gttcctttatcagaaatgttctttaaagaaatgccagctcttggtgaagaagaacaacaa
gtgatcaatggggagcaagtaccagagttaatgacgcacttattcagtaaattagaagca
cttgaaccatttgaagcggctgaaattaaaaagacaattaaagaagttcaaaaagaaaca
ggaataaaaggcaagcaattatttatgcctattcgtgttgctgtaacaggccaaatgcat
ggtcctgaattaccaaatacaattgaagtacttggaaaagaaaaagtgctaaaccgttta
aaacaatataagtaa

DBGET integrated database retrieval system