KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0765Help
Entry
M013TW_0765       CDS       T01744                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M013TW_0765
   01230 Biosynthesis of amino acids
    M013TW_0765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_0765
   00051 Fructose and mannose metabolism
    M013TW_0765
   00562 Inositol phosphate metabolism
    M013TW_0765
Enzymes [BR:suu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M013TW_0765
Exosome [BR:suu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M013TW_0765
  Exosomal proteins of bladder cancer cells
   M013TW_0765
  Exosomal proteins of melanoma cells
   M013TW_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
829223..829984
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTISDLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataacggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcatgctattttcaaa
catggtatgacaccaattatttgtgttggtgaaacagacgaagaacgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagagcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaactatttctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system