KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0770Help
Entry
M013TW_0770       CDS       T01744                                 

Definition
(GenBank) Carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Brite
Enzymes [BR:suu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     M013TW_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 DLH Abhydrolase_1 Peptidase_S9 Abhydrolase_6 BAAT_C Abhydrolase_3 PhoPQ_related FSH1 DUF2048 Chlorophyllase2 DUF4611 Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: AEV77839
Position
834164..834904
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCSPMGG
KTEGAIYEGFLEYARNFKKYEGKDQEAIDNEMHHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtccgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccgcaatatgaaggccatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgttctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gaaggtaaagatcaagaagcgattgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtttttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system