KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1135Help
Entry
M013TW_1135       CDS       T01744                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00240  Pyrimidine metabolism
suu00250  Alanine, aspartate and glutamate metabolism
suu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M013TW_1135
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M013TW_1135
Enzymes [BR:suu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     M013TW_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEV78194
Position
1188097..1188978
Genome map
AA seq 293 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaagtctggtgaacgtcaactaccaaactttgaaggaaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcaacatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccgtttaataactactatgaaaaattagcgaatattaacatcccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttgcttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgtattgatttgtggagacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcaccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaagacatggtcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtgcgctat
aacaaattacaagaacatgctattgttatgcatccggcacctgtgaatagaggagtagaa
atacaaagcgatttagtagaagcttcaaaatcaagaatttttaagcaaatggaaaatggc
gtttacttaagaatggcagtcattgatgaattattaaaatag

DBGET integrated database retrieval system