KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1316Help
Entry
M013TW_1316       CDS       T01744                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suu01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:suu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383674..1384342
Genome map
AA seq 222 aa AA seqDB search
MTILAEIVKYKQSLLQNGYYQDKLNTLKSVNIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYEKYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKNQIIIIFLKVVFTMHLM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttagcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaatattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaatcaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaaaagtatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacaacaaaaacaacattacccgtattatgcaaagattttattatagatccg
cttcaaattgatgttgctaaacaagcaggtgcatctatgattttattgatcgttaacatc
ttatcggataaacaattgaaagatttatataactacgctatatcgcaaaatttagaagtg
ctagttgaagtacatgatcgtcatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacatacaaatact
attttagaaaataaaaaccaaatcattattatatttctgaaagtggtattcacgatgcat
ctgatgtaa

DBGET integrated database retrieval system