KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1357Help
Entry
M013TW_1357       CDS       T01744                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component(E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00020  Citrate cycle (TCA cycle)
suu00310  Lysine degradation
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01120  Microbial metabolism in diverse environments
suu01130  Biosynthesis of antibiotics
suu01200  Carbon metabolism
Module
suu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M013TW_1357
  Amino acid metabolism
   00310 Lysine degradation
    M013TW_1357
Enzymes [BR:suu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     M013TW_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEV78413
Position
complement(1425184..1426452)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADKAEVNQTTD
DNQQRVNATPSARRYARENGVNLAEVSPKTNDLVRKEDIDKKQQAPASTQTTQQAPAKEE
KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKDQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgaagaaacaaataat
aaaaaagaagaaacaacaaataaatcggcagataaagctgaagtcaatcaaacaactgat
gacaatcagcagcgtgttaatgctacaccttctgcgcgtcgatatgctcgtgaaaatggt
gtgaatcttgctgaagtaagtccgaaaacaaatgatcttgttcgtaaagaagatattgat
aagaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaagag
aaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgcagaaag
aaaacagctgctaaaaaattattagaggtatctaataatacagctatgttaacaactttt
aacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaccaatttatg
aaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgtagca
gctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacgaaa
caatattatgatattggtgtagctgtttctacagatgatggattattagtaccattcgta
agagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagcagtt
aaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgattaca
aatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagctgca
attttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaagaa
gcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttattatta
gaatcttaa

DBGET integrated database retrieval system