KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1682Help
Entry
M013TW_1682       CDS       T01744                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M013TW_1682
Enzymes [BR:suu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     M013TW_1682
Exosome [BR:suu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M013TW_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741048..1742022)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSATMRDMVRENHVRKEDLIYPIFVVEKDDVKKEIKSLPGVYQISLNLLE
SELKEAYDLGIRAIMFFGVPNSKDDIGTGAYIHDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRRGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNVPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattgagatcatcagcgacaatgagagatatggttaga
gagaatcatgtaagaaaagaagatttaatatatccaatttttgtagttgaaaaagacgat
gtgaaaaaagaaattaagtcattgccaggtgtataccaaatcagtttgaatttacttgaa
agtgaattaaaagaagcttatgacttaggtatacgtgccattatgttttttggtgttcca
aactcaaaagatgatataggtactggtgcatacattcacgatggtgttattcaacaggca
acacgtattgctaaaaaaatgtatgatgacttattaattgttgcagacacttgtttgtgt
gaatatactgatcatggtcattgtggtgtgattgatgaccatacacatgacgttgacaat
gataaatcattaccactacttgttaaaacagcaatttctcaagtggaagctggagctgat
attattgcaccaagtaatatgatggatggttttgttgctgaaattcgtcgtggacttgat
gaagccggctattacaatattccaataatgagttatggtgtcaagtatgcatctagtttc
tttggaccttttagagatgcagcagattcagcgccatcatttggtgatagaaaaacgtat
cagatggaccctgctaaccgtttggaagcacttcgtgaattagaaagtgatcttaaagaa
gggtgcgacatgatgattgttaaacctgctctaagttatttagacatagttcgagatgtt
aaaaatcatacgaatgttccagttgttgcatataatgtgagtggagaatatagtatgact
aaagcagcggcacaaaatggttggatagatgaagaacgtgtcgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattattacttattttgcaaaggacatttgtcgc
tatttagataaataa

DBGET integrated database retrieval system