KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1711Help
Entry
M013TW_1711       CDS       T01744                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M013TW_1711
   01230 Biosynthesis of amino acids
    M013TW_1711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_1711
   00030 Pentose phosphate pathway
    M013TW_1711
   00051 Fructose and mannose metabolism
    M013TW_1711
   00052 Galactose metabolism
    M013TW_1711
  Energy metabolism
   00680 Methane metabolism
    M013TW_1711
Enzymes [BR:suu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M013TW_1711
Protein phosphatases and associated proteins [BR:suu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     M013TW_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1776720..1777688)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattaggatcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagcattaaatacgattattggattagtcgacaaaattagagatactgcgtca
agtcacgcacgaacatttatcattgaggcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system