KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_2606Help
Entry
M013TW_2606       CDS       T01744                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M013TW_2606
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M013TW_2606
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M013TW_2606
Enzymes [BR:suu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     M013TW_2606
Exosome [BR:suu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M013TW_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2682655..2684079
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALNKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gttttcagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgatccgcatgctaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggtcataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacggtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggtggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttatgat
cttgccacgaacagtaaggagttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttaataagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaagcataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagctaaaaagactactt
aaaaaagaaaaagacgaaaaatccgcagaagtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttatggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system