KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_02225Help
Entry
SAVC_02225        CDS       T01745                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:suv00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511182..512636
Genome map
AA seq 484 aa AA seqDB search
MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF
DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN
GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSKEEF
IKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEEDL
SWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVINGEQVPELMTHLFSKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVLNRL
KQYK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgtataagagtaagatatgcaccaagtccaactgggtatcttcatattggt
aatgcaagaacagcattattcaattacttgtatgctaaacattacaacggagattttgtg
attcgaattgaagatactgataaaaaacgtaatttagaagatggagaaacatcacaattt
gataatcttaaatggttaggattagattgggatgagtctgtagataaagacaatggctac
ggaccatatcgtcaatctgaacgtcaacatatctaccaaccattaatagatcagttacta
gcagaagataaagcatataaatgctatatgacagaagaagaattagaagctgaacgtgaa
gcgcaaatcgctcgtggtgaaatgcctcgctatggtggtcaacatgcgcatttgactgaa
gaacaacgtcaacaatttgaagcagaaggacgccaaccatcaattcgtttccgagtacct
caaaaccaaacgtattcatttgatgatatggtaaaaggaaatatttcatttgattcaaat
ggtattggtgactgggttatcgtaaaaaaagatggcattccaacgtacaattttgcagta
gctatagatgatcattacatgcaaatttcagatgtaattcgtggtgatgatcatatttca
aacacgcctaaacaaattatgatttatgaagcatttggctgggagccacctcgttttggt
catatgtcattaattgttaatgaagaacgtaaaaagttaagtaaacgtgatgggcaaatt
ttacaatttattgagcaatatcgtgacttaggttatttacctgaagcgttatttaatttt
attgcgttattaggttggtctcctgaaggtgaagaagaaatcttttctaaagaagaattt
atcaaaatctttgatgaaaagcgtttgtcaaaatcaccagcatttttcgataagcaaaaa
ttagcatgggttaataaccaatatatgaaacaaaaagatactgaaacagtattccaatta
gcattacctcatttaattaaagcaaatttgattcctgaggtgccgtcagaagaggattta
tcttggggacgcaaattaattgcgctttatcaaaaagaaatgagttatgccggtgaaatt
gtacctttatcagaaatgttctttaaagaaatgccagctcttggtgaagaagaacaacaa
gtgattaatggagagcaagtaccagagttaatgacgcacttattcagtaaattagaagca
cttgaaccatttgaagcggctgaaattaaaaagacaattaaagaagttcaaaaagaaaca
ggaataaaaggcaagcaattatttatgcctattcgtgttgctgtaacaggccaaatgcat
ggtcctgaattaccaaatacaattgaagtacttggtaaagaaaaagtgctaaaccgttta
aaacaatataagtaa

DBGET integrated database retrieval system