KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_03130Help
Entry
SAVC_03130        CDS       T01745                                 

Definition
fructose 1-phosphate kinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAVC_03130
Enzymes [BR:suv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SAVC_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690998..691918
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
SVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaatccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctggggggaaaggtatt
aatgtctcgcgcgtcttaaagacattggatgttgagtcaactgccttgggatttgcaggt
ggatttcctgggaaattcattatagatacattaaataacagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttacaacaaatt
aaaaatacaacaagcgaagatatagttattgttgctggaagtgtaccaagtagtattcca
agcgatgcgtatgcgcaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattggctgaaagcgttttaccatatcatccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacacagatgttatt
aaatatggtcgtttgttagttgataaaggtgcgcaatctgttattgtctcgcttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttaacgattgaaaaagcattccaacaagcagtcgcatgcggtactgccacggca
tttgatgaggacttagcaacacgggacgctatagaaaaaataaaatcacaagttacgatt
agcgtacttgatggggagtga

DBGET integrated database retrieval system