KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_03515Help
Entry
SAVC_03515        CDS       T01745                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00010  Glycolysis / Gluconeogenesis
suv00051  Fructose and mannose metabolism
suv00562  Inositol phosphate metabolism
suv01100  Metabolic pathways
suv01110  Biosynthesis of secondary metabolites
suv01120  Microbial metabolism in diverse environments
suv01130  Biosynthesis of antibiotics
suv01200  Carbon metabolism
suv01230  Biosynthesis of amino acids
Module
suv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suv_M00002  Glycolysis, core module involving three-carbon compounds
suv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVC_03515 (tpiA)
   00051 Fructose and mannose metabolism
    SAVC_03515 (tpiA)
   00562 Inositol phosphate metabolism
    SAVC_03515 (tpiA)
Enzymes [BR:suv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAVC_03515 (tpiA)
Exosome [BR:suv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAVC_03515 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAVC_03515 (tpiA)
  Exosomal proteins of melanoma cells
   SAVC_03515 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEZ36866
Structure
PDB: 

Jmol
Position
778443..779204
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNTLPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatacattaccaacactaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatatgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system