KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_04090Help
Entry
SAVC_04090        CDS       T01745                                 

Definition
3-oxoacyl-ACP synthase
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:suv01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:suv00061]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:suv00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
890895..892139
Genome map
AA seq 414 aa AA seqDB search
MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaataaaagagtagttattacaggtatgggagccctttctccaatcggtaat
gatgtcaaaacaacatgggagaatgctctaaaaggcgtaaatggtatcgataaaattaca
cgtatcgatactgaaccttatagcgttcacttagcaggagaacttaaaaactttaatatt
gaagatcatatcgacaaaaaagaagcgcgtcgtatggatagatttactcaatatgcaatt
gtagcagctagagaggctgttaaagatgcgcaattagatatcaatgaaaatactgcagat
cgaatcggtgtatggattggttctggtatcggtggtatggaaacatttgaaattgcacat
aaacaattaatggataaaggcccaagacgtgtgagtccatttttcgtaccaatgttaatt
cctgatatggcaactgggcaagtatcaattgacttaggtgcaaaaggaccaaatggtgca
acagttacagcatgtgcaacaggtacaaattcaatcggagaagcatttaaaattgtgcaa
cgcggtgatgcagatgcaatgattactggtggtacagaagcaccaattactcatatggca
attgctggtttcagtgcaagtcgagcgctttctacaaatgatgacattgaaacagcatgt
cgtccattccaagaaggtagagatggttttgttatgggtgaaggtgctggtattttagta
attgaatctttagaatcagcacaagctcgaggtgccaatatttatgctgagatagttggc
tatggtactacaggtgatgcttatcatattacagcgccagctccagaaggtgaaggtggt
tctagagcaatgcaagcagctatggatgatgctggtattgaacctaaagatgtacaatac
ttaaatgcccatggtacaagtactcctgttggtgacttaaatgaagttaaagctattaaa
aatacatttggtgaagcagctaaacacttaaaagttagctcaacaaaatcaatgactggt
cacttacttggtgcaacaggtggaattgaagcaatcttctcagcgctttcaattaaagac
tctaaagtcgcaccgacaattcatgcggtaacaccagatccagaatgtgatttggatatt
gttccaaatgaagcgcaagaccttgatattacttatgcaatgagtaatagcttaggattc
ggtggacataacgcagtattagtattcaagaaatttgaagcataa

DBGET integrated database retrieval system