KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_04090Help
Entry
SAVC_04090        CDS       T01745                                 

Definition
3-oxoacyl-ACP synthase
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SAVC_04090
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SAVC_04090
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAVC_04090
Enzymes [BR:suv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     SAVC_04090
Lipid biosynthesis proteins [BR:suv01004]
 Fatty acid synthase
  Component type
   SAVC_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
890895..892139
Genome map
AA seq 414 aa AA seqDB search
MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaataaaagagtagttattacaggtatgggagccctttctccaatcggtaat
gatgtcaaaacaacatgggagaatgctctaaaaggcgtaaatggtatcgataaaattaca
cgtatcgatactgaaccttatagcgttcacttagcaggagaacttaaaaactttaatatt
gaagatcatatcgacaaaaaagaagcgcgtcgtatggatagatttactcaatatgcaatt
gtagcagctagagaggctgttaaagatgcgcaattagatatcaatgaaaatactgcagat
cgaatcggtgtatggattggttctggtatcggtggtatggaaacatttgaaattgcacat
aaacaattaatggataaaggcccaagacgtgtgagtccatttttcgtaccaatgttaatt
cctgatatggcaactgggcaagtatcaattgacttaggtgcaaaaggaccaaatggtgca
acagttacagcatgtgcaacaggtacaaattcaatcggagaagcatttaaaattgtgcaa
cgcggtgatgcagatgcaatgattactggtggtacagaagcaccaattactcatatggca
attgctggtttcagtgcaagtcgagcgctttctacaaatgatgacattgaaacagcatgt
cgtccattccaagaaggtagagatggttttgttatgggtgaaggtgctggtattttagta
attgaatctttagaatcagcacaagctcgaggtgccaatatttatgctgagatagttggc
tatggtactacaggtgatgcttatcatattacagcgccagctccagaaggtgaaggtggt
tctagagcaatgcaagcagctatggatgatgctggtattgaacctaaagatgtacaatac
ttaaatgcccatggtacaagtactcctgttggtgacttaaatgaagttaaagctattaaa
aatacatttggtgaagcagctaaacacttaaaagttagctcaacaaaatcaatgactggt
cacttacttggtgcaacaggtggaattgaagcaatcttctcagcgctttcaattaaagac
tctaaagtcgcaccgacaattcatgcggtaacaccagatccagaatgtgatttggatatt
gttccaaatgaagcgcaagaccttgatattacttatgcaatgagtaatagcttaggattc
ggtggacataacgcagtattagtattcaagaaatttgaagcataa

DBGET integrated database retrieval system